IRX1 Recombinant Protein Antigen

Images

 
There are currently no images for IRX1 Protein (NBP1-83090PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IRX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IRX1.

Source: E. coli

Amino Acid Sequence: NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IRX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83090.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IRX1 Recombinant Protein Antigen

  • Homeodomain protein IRXA1
  • iroquois homeobox 1
  • Iroquois homeobox protein 1
  • iroquois-class homeodomain protein IRX-1
  • IRX-5
  • IRXA1

Background

The Iroquois homeobox gene family of transcription factors regulate aspects of embryonic development including anterior/posterior and dorsal/ventral axis patterning in the central nervous system. The Iroquois family are clustered on two loci, IRXA and IRXB, which map to chromosomes 8 and 13 in mice. The IRXA group includes Irx1, Irx2 and Irx4; the IRXB group is comprises Irx3, Irx5 and Irx6. Irx1 and Irx2 are both widely expressed during development in the lung epithelium and also in the ventricular septum. Irx1 and Irx2 also play a role in digit formation (E11.5-E14.5). The Irx gene family members are each expressed in a distinct pattern during mouse heart development. Specifically, Irx1 and Irx2 are expressed in the ventricular septum and Irx3 is expressed in the ventricular trabeculated myocardium. In addition, Irx4 is expressed in the linear heart tube and the AV canal; Irx5 is expressed in the endocardium lining the ventricular and atrial myocardium. Furthermore, the IRX4 gene may modulate cardiac development and function. Although the heart of Irx4- mice appears to develop normally, adult Irx4- mice exhibit cardiomyopathy, including cardiac hypertrophy and decreased contractility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00153572-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00079191-M05
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00010265-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
H00253738-M05
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBL1-12041
Species: Hu
Applications: WB
MAB8398
Species: Hu
Applications: CyTOF-ready, Flow
H00079190-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-84353
Species: Hu
Applications: WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
AF2567
Species: Mu
Applications: IHC, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
AF3444
Species: Hu
Applications: IHC, WB
NBP1-46328
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF3168
Species: Hu
Applications: ICC, WB
NBP3-45790
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB

Publications for IRX1 Protein (NBP1-83090PEP) (0)

There are no publications for IRX1 Protein (NBP1-83090PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRX1 Protein (NBP1-83090PEP) (0)

There are no reviews for IRX1 Protein (NBP1-83090PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IRX1 Protein (NBP1-83090PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRX1 Products

Array NBP1-83090PEP

Blogs on IRX1

There are no specific blogs for IRX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IRX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IRX1