IRX1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IRX1. Source: E. coli
Amino Acid Sequence: NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
IRX1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83090. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for IRX1 Recombinant Protein Antigen
Background
The Iroquois homeobox gene family of transcription factors regulate aspects of embryonic development including anterior/posterior and dorsal/ventral axis patterning in the central nervous system. The Iroquois family are clustered on two loci, IRXA and IRXB, which map to chromosomes 8 and 13 in mice. The IRXA group includes Irx1, Irx2 and Irx4; the IRXB group is comprises Irx3, Irx5 and Irx6. Irx1 and Irx2 are both widely expressed during development in the lung epithelium and also in the ventricular septum. Irx1 and Irx2 also play a role in digit formation (E11.5-E14.5). The Irx gene family members are each expressed in a distinct pattern during mouse heart development. Specifically, Irx1 and Irx2 are expressed in the ventricular septum and Irx3 is expressed in the ventricular trabeculated myocardium. In addition, Irx4 is expressed in the linear heart tube and the AV canal; Irx5 is expressed in the endocardium lining the ventricular and atrial myocardium. Furthermore, the IRX4 gene may modulate cardiac development and function. Although the heart of Irx4- mice appears to develop normally, adult Irx4- mice exhibit cardiomyopathy, including cardiac hypertrophy and decreased contractility.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Publications for IRX1 Protein (NBP1-83090PEP) (0)
There are no publications for IRX1 Protein (NBP1-83090PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IRX1 Protein (NBP1-83090PEP) (0)
There are no reviews for IRX1 Protein (NBP1-83090PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for IRX1 Protein (NBP1-83090PEP) (0)
Additional IRX1 Products
Blogs on IRX1