Recombinant Human IRF9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IRF9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-393 of Human ISGF3G full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
IRF9
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IRF9 Protein

  • IFN-alpha-responsive transcription factor subunit
  • interferon regulatory factor 9
  • Interferon-stimulated gene factor 3 gamma
  • interferon-stimulated transcription factor 3, gamma (48kD)
  • interferon-stimulated transcription factor 3, gamma 48kDa
  • IRF9
  • IRF-9
  • ISGF3 p48 subunit
  • ISGF3
  • ISGF3G
  • ISGF3GISGF-3 gamma
  • p48
  • Transcriptional regulator ISGF3 subunit gamma

Background

ISGF3G( AAH35716, 1 a.a. - 394 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF4715
Species: Mu
Applications: WB
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00007297-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF4049
Species: Hu
Applications: WB, Simple Western
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010379-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for IRF9 Recombinant Protein (H00010379-P01) (0)

There are no publications for IRF9 Recombinant Protein (H00010379-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF9 Recombinant Protein (H00010379-P01) (0)

There are no reviews for IRF9 Recombinant Protein (H00010379-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF9 Recombinant Protein (H00010379-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRF9 Products

Bioinformatics Tool for IRF9 Recombinant Protein (H00010379-P01)

Discover related pathways, diseases and genes to IRF9 Recombinant Protein (H00010379-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF9 Recombinant Protein (H00010379-P01)

Discover more about diseases related to IRF9 Recombinant Protein (H00010379-P01).
 

Pathways for IRF9 Recombinant Protein (H00010379-P01)

View related products by pathway.

PTMs for IRF9 Recombinant Protein (H00010379-P01)

Learn more about PTMs related to IRF9 Recombinant Protein (H00010379-P01).
 

Research Areas for IRF9 Recombinant Protein (H00010379-P01)

Find related products by research area.

Blogs on IRF9

There are no specific blogs for IRF9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IRF9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF9
Entrez