Recombinant Human IPMK Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IPMK Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 251 - 360 of Human IPMK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SSLLFVYEGSSQPTTTKLNDRTLAEKFLSKGQLSDTEVLEYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
IPMK
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IPMK Protein

  • EC 2.7.1.151
  • IMPK
  • Inositol 13,4,6-tetrakisphosphate 5-kinase
  • inositol polyphosphate multikinase

Background

IPMK - inositol polyphosphate multikinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00000518-R01
Species: Hu
NBP1-81589
Species: Hu
Applications: WB, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86712
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IPMK Partial Recombinant Protein (H00253430-Q01) (0)

There are no publications for IPMK Partial Recombinant Protein (H00253430-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IPMK Partial Recombinant Protein (H00253430-Q01) (0)

There are no reviews for IPMK Partial Recombinant Protein (H00253430-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IPMK Partial Recombinant Protein (H00253430-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IPMK Products

Bioinformatics Tool for IPMK Partial Recombinant Protein (H00253430-Q01)

Discover related pathways, diseases and genes to IPMK Partial Recombinant Protein (H00253430-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IPMK Partial Recombinant Protein (H00253430-Q01)

Discover more about diseases related to IPMK Partial Recombinant Protein (H00253430-Q01).
 

Pathways for IPMK Partial Recombinant Protein (H00253430-Q01)

View related products by pathway.

PTMs for IPMK Partial Recombinant Protein (H00253430-Q01)

Learn more about PTMs related to IPMK Partial Recombinant Protein (H00253430-Q01).
 

Research Areas for IPMK Partial Recombinant Protein (H00253430-Q01)

Find related products by research area.

Blogs on IPMK

There are no specific blogs for IPMK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IPMK Antibody
NBP1-89426

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IPMK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IPMK