IP6K3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IP6K3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IP6K3 Antibody - BSA Free
Background
IP6K3, also known as Inositol hexakisphosphate kinase 3, is a 46 kDa 410 amino acid protein, and is involved in the transformation of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate. This protein has also been shown to have interactions with HIST1H2BC, HIST1H2BE, HIST1H2BF, HIST1H2BG, and HIST1H2BI in the inositol pyrophosphates biosynthesis and metabolism pathway. Disease research is currently being studied with relation to IP6K3 and lupus erythematosus and malaria.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC
Publications for IP6K3 Antibody (NBP3-17386) (0)
There are no publications for IP6K3 Antibody (NBP3-17386).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IP6K3 Antibody (NBP3-17386) (0)
There are no reviews for IP6K3 Antibody (NBP3-17386).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for IP6K3 Antibody (NBP3-17386) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IP6K3 Products
Research Areas for IP6K3 Antibody (NBP3-17386)
Find related products by research area.
|
Blogs on IP6K3