Recombinant Human IP3R1 GST (N-Term) Protein

SDS-Page: Recombinant Human IP3R1 Protein [H00003708-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human IP3R1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2470-2577 of Human IP3R1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: ITPR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 37.62 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IP3R1 GST (N-Term) Protein

• DKFZp313E1334
• DKFZp313N1434
• inositol 14,5-triphosphate receptor, type 1
• inositol 14,5-trisphosphate receptor type 1
• InsP3R1
• IP3 receptor isoform 1
• IP3 receptor
• IP3R 1
• IP3R
• IP3R1
• ITPR1
• SCA15
• SCA16
• spinocerebellar ataxia 15
• spinocerebellar ataxia 16
• Type 1 inositol 14,5-trisphosphate receptor
• Type 1 InsP3 receptor

Background

ITPR1 - inositol 1,4,5-triphosphate receptor, type 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for IP3R1 Partial Recombinant Protein (H00003708-Q01)(2)

Publications using H00003708-Q01

• Olson ML, Sandison ME, Chalmers S, McCarron JG. Microdomains of muscarinic acetylcholine and Ins(1,4,5)P(3) receptors create 'Ins(1,4,5)P(3) junctions' and sites of Ca(2)+ wave initiation in smooth muscle. J Cell Sci. 2012-11-15 [PMID: 22946060] (Bovine)
• Jarius S, Wandinger KP, Horn S et al. A new Purkinje cell antibody (anti-Ca) associated with subacute cerebellar ataxia: immunological characterization. J Neuroinflammation 7:21. 2010-03-12 [PMID: 20226058]

Bioinformatics

• Gene Symbol: ITPR1