INTS10 Antibody

Images

 
Immunohistochemistry-Paraffin: INTS10 Antibody [NBP2-38631] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INTS10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFC
Specificity
Specificity of human INTS10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INTS10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
INTS10 Protein (NBP2-38631PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INTS10 Antibody

  • C8orf35
  • INT10
  • integrator complex subunit 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89382
Species: Hu, Rt
Applications: WB, IHC, IHC-P
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67779
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-45545
Species: Hu
Applications: WB, IHC
H00026999-P01
Species: Hu
NBP1-77159
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00011188-Q01
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-38631
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for INTS10 Antibody (NBP2-38631) (0)

There are no publications for INTS10 Antibody (NBP2-38631).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INTS10 Antibody (NBP2-38631) (0)

There are no reviews for INTS10 Antibody (NBP2-38631). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for INTS10 Antibody (NBP2-38631) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional INTS10 Products

Bioinformatics Tool for INTS10 Antibody (NBP2-38631)

Discover related pathways, diseases and genes to INTS10 Antibody (NBP2-38631). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INTS10 Antibody (NBP2-38631)

Discover more about diseases related to INTS10 Antibody (NBP2-38631).
 

Pathways for INTS10 Antibody (NBP2-38631)

View related products by pathway.

Blogs on INTS10

There are no specific blogs for INTS10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INTS10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INTS10
Uniprot