Recombinant Human Integrin beta 6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Integrin beta 6 Protein Summary

Description
Integrin beta 6 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: CTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPN
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ITGB6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Integrin beta 6 Protein

  • Integrin beta 6
  • integrin beta-6
  • integrin, beta 6
  • ITGB6

Background

ITGB6 - integrin, beta 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3050
Species: Hu
Applications: Flow, IHC, IP, AdBlk, CyTOF-ready
AF2818
Species: Hu
Applications: WB, ICC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
AF2405
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
NBP2-58876
Species: Hu
Applications: ICC/IF
NBP1-87447
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006326-Q01
Species: Hu
H00010716-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF446
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF4669
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01) (0)

There are no publications for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01) (0)

There are no reviews for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin beta 6 Products

Related Products by Gene

Bioinformatics Tool for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01)

Discover related pathways, diseases and genes to Integrin beta 6 Partial Recombinant Protein (H00003694-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01)

Discover more about diseases related to Integrin beta 6 Partial Recombinant Protein (H00003694-Q01).
 

Pathways for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01)

View related products by pathway.

PTMs for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01)

Learn more about PTMs related to Integrin beta 6 Partial Recombinant Protein (H00003694-Q01).
 

Research Areas for Integrin beta 6 Partial Recombinant Protein (H00003694-Q01)

Find related products by research area.

Blogs on Integrin beta 6

There are no specific blogs for Integrin beta 6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Integrin beta 6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB6
Entrez

Customers Who Bought This Also Bought