Recombinant Human Integrin alpha 9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Integrin alpha 9 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 785 - 886 of Human ITGA9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR

Protein/Peptide Type
Partial Recombinant Protein
Gene
ITGA9

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Integrin alpha 9 Protein

  • ALPHA-RLC
  • Integrin alpha 9
  • integrin alpha-9
  • Integrin alpha-RLC
  • integrin, alpha 9
  • ITGA4L
  • ITGA9
  • RLC
  • RLC-alpha

Background

ITGA9 - integrin, alpha 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
H00085366-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-56552
Species: Hu
Applications: WB
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003680-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01) (0)

There are no publications for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01) (0)

There are no reviews for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin alpha 9 Products

Bioinformatics Tool for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01)

Discover related pathways, diseases and genes to Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01)

Discover more about diseases related to Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01).
 

Pathways for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01)

View related products by pathway.

PTMs for Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01)

Learn more about PTMs related to Integrin alpha 9 Partial Recombinant Protein (H00003680-Q01).

Blogs on Integrin alpha 9

There are no specific blogs for Integrin alpha 9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Integrin alpha 9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA9
Entrez