Integrin alpha 7 Recombinant Protein Antigen

Images

 
There are currently no images for Integrin alpha 7 Protein (NBP1-86118PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Integrin alpha 7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITGA7.

Source: E. coli

Amino Acid Sequence: FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITGA7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86118.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Integrin alpha 7 Recombinant Protein Antigen

  • FLJ25220
  • integrin alpha 7 chain
  • Integrin alpha 7
  • integrin alpha-7
  • integrin, alpha 7
  • ITGA7

Background

ITGA7 encodes integrin alpha chain 7. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 7 undergoes post-translational cleavage within the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that binds to the extracellular matrix protein laminin-1. Alpha 7 beta 1 is the major integrin complex expressed in differentiated muscle cells. Splice variants of alpha 7 that differ in both the extracellular and cytoplasmic domains exist in the mouse; however, to date only a single human transcript type has been isolated: it contains extracellular and cytoplasmic domains corresponding to the mouse X2 and B variants, respectively. A unique extracellular splice variant has been identified in human, although it clearly represents a minor species and its biological significance is unclear.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-86118
Species: Bv, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP3-15472
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00079147-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
DVC00
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
AF4817
Species: Mu
Applications: Simple Western, WB
7414-GT
Species: Hu
Applications: EnzAct
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-84576
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-12334
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP2-81797
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-86118PEP
Species: Hu
Applications: AC

Publications for Integrin alpha 7 Protein (NBP1-86118PEP) (0)

There are no publications for Integrin alpha 7 Protein (NBP1-86118PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 7 Protein (NBP1-86118PEP) (0)

There are no reviews for Integrin alpha 7 Protein (NBP1-86118PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Integrin alpha 7 Protein (NBP1-86118PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin alpha 7 Products

Research Areas for Integrin alpha 7 Protein (NBP1-86118PEP)

Find related products by research area.

Blogs on Integrin alpha 7

There are no specific blogs for Integrin alpha 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Integrin alpha 7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA7