INSM2 Antibody

Images

 
Western Blot: INSM2 Antibody [NBP2-87628] - WB Suggested Anti-INSM2 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INSM2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human INSM2. Peptide sequence: KRTGGLYRVRLAERVFPLLGPQGAPPFLEEAPSASLPGAERATPPTREEP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
INSM2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for INSM2 Antibody

  • insulinoma-associated 2
  • Nbla106
  • zinc finger protein IA-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7906
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7936
Species: Hu
Applications: IHC, CyTOF-ready, ICFlow
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-97795
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48272
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
AF3444
Species: Hu
Applications: WB
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29430
Species: Hu
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76307
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-330
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready
NBP2-87628
Species: Hu
Applications: WB

Publications for INSM2 Antibody (NBP2-87628) (0)

There are no publications for INSM2 Antibody (NBP2-87628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSM2 Antibody (NBP2-87628) (0)

There are no reviews for INSM2 Antibody (NBP2-87628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSM2 Antibody (NBP2-87628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional INSM2 Products

Array NBP2-87628

Bioinformatics Tool for INSM2 Antibody (NBP2-87628)

Discover related pathways, diseases and genes to INSM2 Antibody (NBP2-87628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on INSM2

There are no specific blogs for INSM2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INSM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INSM2