INPP5E Antibody

Images

 
Immunohistochemistry-Paraffin: INPP5E Antibody [NBP2-49463] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INPP5E Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTICSVS
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INPP5E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
INPP5E Recombinant Protein Antigen (NBP2-49463PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INPP5E Antibody

  • CORS172 kDa inositol polyphosphate 5-phosphatase
  • CPD4
  • EC 3.1.3.36
  • inositol polyphosphate-5-phosphatase, 72 kDa
  • JBTS1
  • Joubert syndrome 1
  • MGC117201
  • MORMS
  • phosphatidylinositol (4,5) bisphosphate 5-phosphatase
  • Phosphatidylinositol polyphosphate 5-phosphatase type IV
  • Phosphatidylinositol-4,5-bisphosphate 5-phosphatase
  • PPI5PIV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80973
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-31705
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP3-16226
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-88692
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-56977
Species: Hu
Applications: ICC/IF, WB
NBP2-15463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33116
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003636-M01
Species: Hu, Pm
Applications: ELISA, ICC/IF, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-15309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DCLU00
Species: Hu
Applications: ELISA
NBP2-49463
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for INPP5E Antibody (NBP2-49463) (0)

There are no publications for INPP5E Antibody (NBP2-49463).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP5E Antibody (NBP2-49463) (0)

There are no reviews for INPP5E Antibody (NBP2-49463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for INPP5E Antibody (NBP2-49463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INPP5E Products

Bioinformatics Tool for INPP5E Antibody (NBP2-49463)

Discover related pathways, diseases and genes to INPP5E Antibody (NBP2-49463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP5E Antibody (NBP2-49463)

Discover more about diseases related to INPP5E Antibody (NBP2-49463).
 

Pathways for INPP5E Antibody (NBP2-49463)

View related products by pathway.

PTMs for INPP5E Antibody (NBP2-49463)

Learn more about PTMs related to INPP5E Antibody (NBP2-49463).
 

Research Areas for INPP5E Antibody (NBP2-49463)

Find related products by research area.

Blogs on INPP5E

There are no specific blogs for INPP5E, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INPP5E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP5E