Recombinant Human ING4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ING4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 73-180 of Human ING4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKSRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ING4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ING4 Protein

  • candidate tumor suppressor p33 ING1 homolog
  • inhibitor of growth family, member 4
  • inhibitor of growth protein 4
  • MGC12557
  • my036
  • p29ING4brain my036 protein

Background

This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-92161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00084289-T01
Species: Hu
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00054556-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC

Publications for ING4 Partial Recombinant Protein (H00051147-Q01) (0)

There are no publications for ING4 Partial Recombinant Protein (H00051147-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ING4 Partial Recombinant Protein (H00051147-Q01) (0)

There are no reviews for ING4 Partial Recombinant Protein (H00051147-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ING4 Partial Recombinant Protein (H00051147-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ING4 Products

Bioinformatics Tool for ING4 Partial Recombinant Protein (H00051147-Q01)

Discover related pathways, diseases and genes to ING4 Partial Recombinant Protein (H00051147-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ING4 Partial Recombinant Protein (H00051147-Q01)

Discover more about diseases related to ING4 Partial Recombinant Protein (H00051147-Q01).
 

Pathways for ING4 Partial Recombinant Protein (H00051147-Q01)

View related products by pathway.

PTMs for ING4 Partial Recombinant Protein (H00051147-Q01)

Learn more about PTMs related to ING4 Partial Recombinant Protein (H00051147-Q01).
 

Research Areas for ING4 Partial Recombinant Protein (H00051147-Q01)

Find related products by research area.

Blogs on ING4

There are no specific blogs for ING4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ING4 Antibody
H00051147-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ING4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ING4