Recombinant Human ILK Protein

Images

 
SDS-Page: ILK Recombinant Protein [H00003611-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ILK Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 452 of Human ILK full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ILK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
77.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ILK Protein

  • 59 kDa serine/threonine-protein kinase
  • DKFZp686F1765
  • EC 2.7.11.1
  • ESTM24
  • ILK
  • ILK1
  • ILK-1
  • ILK2
  • ILK-2
  • integrin-linked kinase
  • integrin-linked kinase-2
  • integrin-linked protein kinase
  • p59
  • p59ILK

Background

Transduction of extracellular matrix signals through integrins influences intracellular and extracellular functions, and appears to require interaction of integrin cytoplasmic domains with cellular proteins. Integrin-linked kinase (ILK), interacts with the cytoplasmic domain of beta-1 integrin. This gene encodes a serine/threonine protein kinase with 4 ankyrin-like repeats, which associates with the cytoplasmic domain of beta integrins and acts as a proximal receptor kinase regulating integrin-mediated signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6257
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-46326
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IP, B/N
NBP2-46327
Species: Hu
Applications: WB, IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

Publications for ILK Recombinant Protein (H00003611-P01) (0)

There are no publications for ILK Recombinant Protein (H00003611-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILK Recombinant Protein (H00003611-P01) (0)

There are no reviews for ILK Recombinant Protein (H00003611-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ILK Recombinant Protein (H00003611-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ILK Recombinant Protein (H00003611-P01)

Discover related pathways, diseases and genes to ILK Recombinant Protein (H00003611-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILK Recombinant Protein (H00003611-P01)

Discover more about diseases related to ILK Recombinant Protein (H00003611-P01).
 

Pathways for ILK Recombinant Protein (H00003611-P01)

View related products by pathway.

PTMs for ILK Recombinant Protein (H00003611-P01)

Learn more about PTMs related to ILK Recombinant Protein (H00003611-P01).
 

Research Areas for ILK Recombinant Protein (H00003611-P01)

Find related products by research area.

Blogs on ILK.

Inhibitor kappa B-alpha (IkappaB-alpha)
The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess...  Read full blog post.

Customers Who Bought This Also Bought

ILK Antibody (4F10)
H00003611-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ILK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ILK
Entrez