Recombinant Human ILK Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ILK Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 341-452 of Human ILK

Source: Wheat Germ

Amino Acid Sequence: KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ILK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
38.06 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ILK Protein

  • 59 kDa serine/threonine-protein kinase
  • DKFZp686F1765
  • EC 2.7.11.1
  • ESTM24
  • ILK
  • ILK1
  • ILK-1
  • ILK2
  • ILK-2
  • integrin-linked kinase
  • integrin-linked kinase-2
  • integrin-linked protein kinase
  • p59
  • p59ILK

Background

ILK - integrin-linked kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6257
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Hu, Mu, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46326
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-46327
Species: Hu
Applications: WB, IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

Publications for ILK Partial Recombinant Protein (H00003611-Q01) (0)

There are no publications for ILK Partial Recombinant Protein (H00003611-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILK Partial Recombinant Protein (H00003611-Q01) (0)

There are no reviews for ILK Partial Recombinant Protein (H00003611-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ILK Partial Recombinant Protein (H00003611-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ILK Products

Bioinformatics Tool for ILK Partial Recombinant Protein (H00003611-Q01)

Discover related pathways, diseases and genes to ILK Partial Recombinant Protein (H00003611-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILK Partial Recombinant Protein (H00003611-Q01)

Discover more about diseases related to ILK Partial Recombinant Protein (H00003611-Q01).
 

Pathways for ILK Partial Recombinant Protein (H00003611-Q01)

View related products by pathway.

PTMs for ILK Partial Recombinant Protein (H00003611-Q01)

Learn more about PTMs related to ILK Partial Recombinant Protein (H00003611-Q01).
 

Research Areas for ILK Partial Recombinant Protein (H00003611-Q01)

Find related products by research area.

Blogs on ILK.

Inhibitor kappa B-alpha (IkappaB-alpha)
The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess...  Read full blog post.

Customers Who Bought This Also Bought

ILK Antibody (4F10)
H00003611-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ILK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ILK
Entrez