ILF3 Antibody - BSA Free

Images

 
Western Blot: ILF3 Antibody [NBP1-58226] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
Immunohistochemistry: ILF3 Antibody [NBP1-58226] - Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Immunohistochemistry-Paraffin: ILF3 Antibody [NBP1-58226] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
Immunohistochemistry: ILF3 Antibody [NBP1-58226] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

ILF3 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ILF3 (interleukin enhancer binding factor 3, 90kDa) The peptide sequence was selected from the N terminal of ILF3. Peptide sequence ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ILF3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ILF3 Antibody - BSA Free

  • Double-stranded RNA-binding protein 76
  • double-stranded RNA-binding protein, 76 kD
  • DRBF
  • DRBP76M-phase phosphoprotein 4
  • dsRNA binding protein NFAR-2/MPP4
  • interleukin enhancer binding factor 3, 90kDa
  • interleukin enhancer-binding factor 3
  • MPHOSPH4interleukin enhancer binding factor 3, 90kD
  • MPP4MMP4
  • NF90CBTF
  • NFAR-1
  • NFAR2
  • NFARNF110
  • NF-AT-90
  • Nuclear factor associated with dsRNA
  • Nuclear factor of activated T-cells 90 kDa
  • nuclear factor of activated T-cells, 90 kD
  • TCP110
  • TCP80
  • Translational control protein 80

Background

ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity. ILF3 may regulate transcription of the IL2 gene during T-cell activation. It can promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82586
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
202-IL
Species: Hu
Applications: BA
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
AF3235
Species: Hu, Mu, Rt
Applications: IHC, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00057510-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-14193
Species: Hu
Applications: IHC,  IHC-P
NB110-40579
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP3-16561
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6016
Species: Hu, Mu
Applications: WB
NBP1-90242
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-58226
Species: Hu
Applications: WB, IHC

Publications for ILF3 Antibody (NBP1-58226) (0)

There are no publications for ILF3 Antibody (NBP1-58226).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILF3 Antibody (NBP1-58226) (0)

There are no reviews for ILF3 Antibody (NBP1-58226). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ILF3 Antibody (NBP1-58226) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ILF3 Products

Research Areas for ILF3 Antibody (NBP1-58226)

Find related products by research area.

Blogs on ILF3

There are no specific blogs for ILF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ILF3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ILF3
Uniprot