ILF3 Antibody

Western Blot: ILF3 Antibody [NBP1-58225] - Titration: 0.0625ug/ml Positive Control: Raji cell lysate.

Immunohistochemistry-Paraffin: ILF3 Antibody [NBP1-58225] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ILF3 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ILF3 (interleukin enhancer binding factor 3, 90kDa) The peptide sequence was selected from the N terminal of ILF3 (NP_004507). Peptide sequence PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ILF3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: In WB, antibody detects both full length 95 kDa protein and 76 kDa isoform.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ILF3 Antibody

• Double-stranded RNA-binding protein 76
• double-stranded RNA-binding protein, 76 kD
• DRBF
• DRBP76M-phase phosphoprotein 4
• dsRNA binding protein NFAR-2/MPP4
• interleukin enhancer binding factor 3, 90kDa
• interleukin enhancer-binding factor 3
• MPHOSPH4interleukin enhancer binding factor 3, 90kD
• MPP4MMP4
• NF90CBTF
• NFAR-1
• NFAR2
• NFARNF110
• NF-AT-90
• Nuclear factor associated with dsRNA
• Nuclear factor of activated T-cells 90 kDa
• nuclear factor of activated T-cells, 90 kD
• TCP110
• TCP80
• Translational control protein 80

Background

ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity. ILF3 may regulate transcription of the IL2 gene during T-cell activation. It can promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ILF3
• Entrez:
  • 3609(Human)
• Uniprot:
  • Q12906-2(Human)