ILF3 Antibody (0S2N7)

Western Blot: ILF3 Antibody (0S2N7) [NBP3-16664] - Western blot analysis of extracts of various cell lines, using ILF3 Rabbit mAb (NBP3-16664) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human cervix cancer tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human colon carcinoma tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse colon tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human colon tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse brain tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human liver tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded rat liver tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human thyroid cancer tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded rat colon tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse lung tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse testis tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 0S2N7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ILF3 Antibody (0S2N7) Summary

• Description: Novus Biologicals Rabbit ILF3 Antibody (0S2N7) (NBP3-16664) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ILF3 (Q12906). MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ILF3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 95 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ILF3 Antibody (0S2N7)

• Double-stranded RNA-binding protein 76
• double-stranded RNA-binding protein, 76 kD
• DRBF
• DRBP76M-phase phosphoprotein 4
• dsRNA binding protein NFAR-2/MPP4
• interleukin enhancer binding factor 3, 90kDa
• interleukin enhancer-binding factor 3
• MPHOSPH4interleukin enhancer binding factor 3, 90kD
• MPP4MMP4
• NF90CBTF
• NFAR-1
• NFAR2
• NFARNF110
• NF-AT-90
• Nuclear factor associated with dsRNA
• Nuclear factor of activated T-cells 90 kDa
• nuclear factor of activated T-cells, 90 kD
• TCP110
• TCP80
• Translational control protein 80

Background

ILF3 encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein was first discovered to be a subunit of the nuclear factor of activated T-cells (NFAT); a transcription factor required for T-cell expression of interleukin 2. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. These proteins have been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth; possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ILF3