ILF2 Recombinant Protein Antigen

Images

 
There are currently no images for ILF2 Recombinant Protein Antigen (NBP1-82586PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ILF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ILF2.

Source: E. coli

Amino Acid Sequence: PFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ILF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82586.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ILF2 Recombinant Protein Antigen

  • interleukin enhancer binding factor 2, 45kD
  • interleukin enhancer binding factor 2, 45kDa
  • interleukin enhancer-binding factor 2
  • MGC8391
  • NF45PRO3063
  • Nuclear factor of activated T-cells 45 kDa
  • nuclear factor of activated T-cells, 45-kDa

Background

Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84056
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-22128
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
H00007520-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, QFN, S-ELISA, WB
AF3235
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-83754
Species: Hu
Applications: IHC,  IHC-P
NB110-40579
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB500-123
Species: Hu, Mu
Applications: B/N, ChIP, Func, ICC/IF, IHC,  IHC-P, IP, WB
DY413
Species: Mu
Applications: ELISA
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00057510-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
H00002547-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP3-32238
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-82586PEP
Species: Hu
Applications: AC

Publications for ILF2 Recombinant Protein Antigen (NBP1-82586PEP) (0)

There are no publications for ILF2 Recombinant Protein Antigen (NBP1-82586PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILF2 Recombinant Protein Antigen (NBP1-82586PEP) (0)

There are no reviews for ILF2 Recombinant Protein Antigen (NBP1-82586PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ILF2 Recombinant Protein Antigen (NBP1-82586PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ILF2 Products

Blogs on ILF2

There are no specific blogs for ILF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ILF2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ILF2