Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | ELISA, IHC |
Clonality | Polyclonal |
Host | Goat |
Conjugate | Unconjugated |
Format | BSA Free |
Immunogen | Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. |
Localization | Secreted |
Specificity | IL22 RA2 |
Isotype | IgG |
Clonality | Polyclonal |
Host | Goat |
Gene | IL22RA2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | 10mM KHPO4 and 0.14M NaCl, pH 7.2 |
Preservative | 0.1% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NB100-742 | Applications | Species |
---|---|---|
de Brito RJVC, do Carmo RF, Silva BMS et al. Liver expression of IL-22, IL-22R1 and IL-22BP in patients with chronic hepatitis C with different fibrosis stages Cytokine 2021-12-15 [PMID: 34920229] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for IL-22BP/IL22 RA2 Antibody (NB100-742)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.