IL-20R alpha Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit IL-20R alpha Antibody - BSA Free (NBP1-89633) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IL20RA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IL-20R alpha Antibody - BSA Free
Background
Official Gene Symbol: IL20RA Gene ID: 53832 (Human) Gene Map Locus: 6q22.33-q23.1 (Human) IL20RA, is a subunit of IL20R, a member of Cytokine Class II receptor super family. It consists of a central transmembrane domain and functionally induces IL20 and IL26 signaling in epithelial cells and keratinocytes. It associates with IL-20RB and forms a functional receptor complex for IL20, IL19, and IL24. It also associates with IL-10RB and forms a unique heterodimeric functional receptor complex for IL-26. Upon ligand binding, it induces signaling through activation of STAT3 and STAT1. IL20RA is specifically expressed in skin suggesting a prominent role in growth and proliferation of keratinocytes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Neut
Species: Mu
Applications: ELISA
Publications for IL-20R alpha Antibody (NBP1-89633) (0)
There are no publications for IL-20R alpha Antibody (NBP1-89633).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-20R alpha Antibody (NBP1-89633) (0)
There are no reviews for IL-20R alpha Antibody (NBP1-89633).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for IL-20R alpha Antibody (NBP1-89633) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-20R alpha Products
Blogs on IL-20R alpha