IL-20R alpha Antibody - BSA Free

Immunohistochemistry: IL-20 R alpha Antibody [NBP1-89633] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-20R alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-20R alpha Antibody - BSA Free (NBP1-89633) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL20RA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-20R alpha Recombinant Protein Antigen (NBP1-89633PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-20R alpha Antibody - BSA Free

• class II cytokine receptor ZCYTOR7
• CRF2-8
• Cytokine receptor class-II member 8
• Cytokine receptor family 2 member 8
• FLJ40993
• IL-20 R alpha
• IL20R alpha
• IL-20R alpha
• IL-20R1
• IL-20R1IL-20 receptor subunit alpha
• IL20RA
• IL-20Ra
• IL-20R-alpha
• interleukin 20 receptor, alpha
• interleukin-20 receptor I
• interleukin-20 receptor subunit alpha
• zcytor7

Background

Official Gene Symbol: IL20RA Gene ID: 53832 (Human) Gene Map Locus: 6q22.33-q23.1 (Human) IL20RA, is a subunit of IL20R, a member of Cytokine Class II receptor super family. It consists of a central transmembrane domain and functionally induces IL20 and IL26 signaling in epithelial cells and keratinocytes. It associates with IL-20RB and forms a functional receptor complex for IL20, IL19, and IL24. It also associates with IL-10RB and forms a unique heterodimeric functional receptor complex for IL-26. Upon ligand binding, it induces signaling through activation of STAT3 and STAT1. IL20RA is specifically expressed in skin suggesting a prominent role in growth and proliferation of keratinocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL20RA