IL-20 R beta/FNDC6 Antibody Summary
| Immunogen |
IL20RB (AAH33292.1, 1 a.a. - 147 a.a.) full-length human protein. MKHLLMWSPVIAPGETVYHSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
IL20RB |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Immunogen affinity purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IL-20 R beta/FNDC6 Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ICC/IF
Publications for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)
There are no publications for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)
There are no reviews for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-20 R beta/FNDC6 Products
Array H00053833-B02P-50ug
Blogs on IL-20 R beta/FNDC6