Home » IL-20 R beta/FNDC6 » IL-20 R beta/FNDC6 Antibodies » IL-20 R beta/FNDC6 Antibody

IL-20 R beta/FNDC6 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: IL-20 R beta/FNDC6 Antibody [H00053833-B02P-50ug] - Analysis of IL20RB expression in transfected 293T cell line (H00053833-T02) by IL20RB MaxPab polyclonal antibody. Lane 1: IL20RB transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.
Western Blot: IL-20 R beta/FNDC6 Antibody [H00053833-B02P-50ug] - Analysis of IL20RB expression in transfected 293T cell line (H00053833-T02) by IL20RB MaxPab polyclonal antibody. Lane 1: IL20RB transfected ...read more
Immunocytochemistry/ Immunofluorescence: IL-20 R beta/FNDC6 Antibody [H00053833-B02P-50ug] - HeLa cell. [antibody concentration 10 ug/ml]

Product Details

Summary
Product Discontinued
View other related IL-20 R beta/FNDC6 Primary Antibodies

Order Details


    • Catalog Number
      H00053833-B02P-50ug
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-20 R beta/FNDC6 Antibody Summary

Immunogen
IL20RB (AAH33292.1, 1 a.a. - 147 a.a.) full-length human protein. MKHLLMWSPVIAPGETVYHSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IL20RB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-20 R beta/FNDC6 Antibody

  • FNDC6
  • DIRS1
  • FNDC6
  • IL-20 R beta
  • IL20R beta
  • IL-20R2
  • IL20RB interleukin 20 receptor beta
  • IL20RB
  • IL-20Rb
  • MGC34923

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-17B Antibody
[Unconjugated]
AF1709
M‑NFS‑60 mouse myelogenous leukemia lymphoblast cell line was stained with Goat Anti-Mouse IL‑17B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1709, filled histogram) or isotype control antibody (Catalog # AB‑108‑C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(1 Publication)
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
IL-20
[Unconjugated]
1102-IL/CF
IL-20 [Unconjugated]
(11 Publications)
Species: Hu
Applications: BA
IL-17F [Biotin]
DY2057
(13 Publications)
Species: Mu
Applications: ELISA
IL-20R alpha
Antibody (173707) [Un ...
MAB11761
IL‑20 R alpha  was detected in immersion fixed paraffin-embedded sections of human skin using 8 µg/mL Mouse Anti‑HumanIL‑20 R alpha  Monoclonal Antibody (Catalog # MAB11761) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: IHC
IL-10 [Biotin]
DY417
(10 Reviews)
(253 Publications)
Species: Mu
Applications: ELISA
IL-24
[Unconjugated]
1965-IL/CF
IL-24 [Unconjugated]
(17 Publications)
Species: Hu
Applications: BA
IL-19
[Unconjugated]
2915-IL/CF
IL-19 [Unconjugated]
(7 Publications)
Species: Mu
Applications: BA
IL-22
[Unconjugated]
782-IL/CF
1 µg/lane of Recombinant Human IL-22 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-22 (Catalog # 782‑IL/CF) induces IL-10 secretion in the COLO 205 human colorectal adenocarcinoma cell line. The ED50 for this effect is 60‑300 pg/mL.
(64 Publications)
Species: Hu
Applications: BA
IL-19
[Unconjugated]
2915-IL/CF
IL-19 [Unconjugated]
(7 Publications)
Species: Mu
Applications: BA
IL-17D Antibody
(246018) [Unconjugate
MAB15041
IL‑17D was detected in immersion fixed paraffin-embedded sections of human heart using 25 µg/mL Human IL‑17D Monoclonal Antibody (Catalog # MAB15041) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Human peripheral blood mononuclear cells were stained with Human IL‑17D Monoclonal Antibody (Catalog # MAB15041, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
IL-26/AK155
Antibody
AF1375
IL-26/AK155 Antibody
(5 Publications)
Species: Hu
Applications: WB
STAT3 Antibody
(232209) [Unconjugate
MAB1799
STAT3 was detected in immersion fixed HeLa human cervicalepithelial carcinoma cell line treated with IFN-alpha 1, but is not detected inSTAT3 knockout (KO) HeLa cell line using Mouse Anti-Human/Mouse/Rat STAT3Monoclonal Antibody (Catalog # MAB1799) at 1 µg/mL for 3 hours at roomtemperature. Cells were stained using the NorthernLights™ 557-conjugatedAnti-Mouse IgG Secondary Antibody (red; Catalog # NL007)and counterstained with DAPI (blue). Specific staining was localized tocytoplasm and nuclei. View our protocol for FluorescentICC Staining of Cells on Coverslips.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human STAT3 Monoclonal Antibody (Catalog # MAB1799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for STAT3 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line, STAT1 knockout (KO) HeLa cell line, STAT2 KO HeLa cell line, STAT3 KO HeLa cell line, STAT5a KO HeLa cell line, STAT5b KO HeLa cell line, STAT6 KO HeLa cell line,. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (Catalog # MAB1799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for STAT3 at approximately 80 kDa (as indicated) in the parental HeLacell line, but is not detectable in the STAT3 knockout HeLa cell line. GAPDH(Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
IL-10 R beta
Antibody (90220) [Unc ...
MAB874
Recombinant Human IL‑10 (Catalog # 217-IL) inhibits IL‑1 beta secretion in LPS-activated human peripheral blood mononuclear cells (PBMC) in a dose-dependent manner (orange line), as measured by the Human IL‑1 beta /IL‑1F2 Quantikine ELISA Kit (Catalog # DLB50). IL‑1 beta secre­tion inhibited by Recombinant Human IL‑10 (0.25 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL‑10 R beta Monoclonal Antibody (Catalog # MAB874). The ND50 is typically 0.5-2 µg/mL in the presence of LPS (0.25 ng/mL).
Human PBMC monocytes were stained with Mouse Anti-Human IL‑10 R beta Monoclonal Antibody (Catalog # MAB874, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram) followed by PE-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(1 Review)
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(718 Publications)
Species: Hu
Applications: BA
IL-22BP/IL22 RA2
[Unconjugated]
8498-BP
IL-22BP/IL22 RA2 [Unconjugated]
Species: Hu
Applications: BA
ACAT Antibody
NB400-141
ACAT Antibody
(6 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
IL-6 [HRP]
D6050
(32 Reviews)
(636 Publications)
Species: Hu
Applications: ELISA
KGF/FGF-7
[Unconjugated]
251-KG/CF
Recombinant Human KGF/FGF-7 (Catalog # 251-KG/CF) stimulates cell proliferation of 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 6‑60 ng/mL.
(68 Publications)
Species: Hu
Applications: BA

Publications for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)

There are no publications for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)

There are no reviews for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-20 R beta/FNDC6 Products

Bioinformatics Tool for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug)

Discover related pathways, diseases and genes to IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug)

Discover more about diseases related to IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug).
 

Pathways for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug)

View related products by pathway.

Blogs on IL-20 R beta/FNDC6

There are no specific blogs for IL-20 R beta/FNDC6, but you can read our latest blog posts.
Omicron Variant Antibodies

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-20 R beta/FNDC6 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IL20RB
Entrez
OMIM
Uniprot