IL-20 R beta/FNDC6 Antibody

Images

 
Western Blot: IL-20 R beta/FNDC6 Antibody [H00053833-B02P-50ug] - Analysis of IL20RB expression in transfected 293T cell line (H00053833-T02) by IL20RB MaxPab polyclonal antibody. Lane 1: IL20RB transfected ...read more
Immunocytochemistry/ Immunofluorescence: IL-20 R beta/FNDC6 Antibody [H00053833-B02P-50ug] - HeLa cell. [antibody concentration 10 ug/ml]

Product Details

Summary
Product Discontinued
View other related IL-20 R beta/FNDC6 Primary Antibodies

Order Details


    • Catalog Number
      H00053833-B02P-50ug
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-20 R beta/FNDC6 Antibody Summary

Immunogen
IL20RB (AAH33292.1, 1 a.a. - 147 a.a.) full-length human protein. MKHLLMWSPVIAPGETVYHSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IL20RB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-20 R beta/FNDC6 Antibody

  • FNDC6
  • DIRS1
  • FNDC6
  • IL-20 R beta
  • IL20R beta
  • IL-20R2
  • IL20RB interleukin 20 receptor beta
  • IL20RB
  • IL-20Rb
  • MGC34923

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1709
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
1102-IL/CF
Species: Hu
Applications: BA
DY2057
Species: Mu
Applications: ELISA
MAB11761
Species: Hu
Applications: IHC
DY417
Species: Mu
Applications: ELISA
1965-IL/CF
Species: Hu
Applications: BA
2915-IL/CF
Species: Mu
Applications: BA
782-IL/CF
Species: Hu
Applications: BA
2915-IL/CF
Species: Mu
Applications: BA
MAB15041
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
AF1375
Species: Hu
Applications: WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
MAB874
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
8498-BP
Species: Hu
Applications: BA
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
D6050
Species: Hu
Applications: ELISA
251-KG/CF
Species: Hu
Applications: BA

Publications for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)

There are no publications for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)

There are no reviews for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-20 R beta/FNDC6 Products

Bioinformatics Tool for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug)

Discover related pathways, diseases and genes to IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug)

Discover more about diseases related to IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug).
 

Pathways for IL-20 R beta/FNDC6 Antibody (H00053833-B02P-50ug)

View related products by pathway.

Blogs on IL-20 R beta/FNDC6

There are no specific blogs for IL-20 R beta/FNDC6, but you can read our latest blog posts.
Omicron Variant Antibodies

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-20 R beta/FNDC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL20RB
Entrez
OMIM
Uniprot