Recombinant Human IKZF5 Protein

Images

 
SDS-Page: Recombinant Human IKZF5 Protein [H00064376-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human IKZF5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-100 of Human IKZF5

Source: Wheat Germ

Amino Acid Sequence: GEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVEVSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEH

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
IKZF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IKZF5 Protein

  • DKFZp781B0249
  • FLJ22973
  • IKAROS family zinc finger 5 (Pegasus)
  • Ikaros family zinc finger protein 5
  • PEGASUS
  • zinc finger protein Pegasus
  • zinc finger protein, subfamily 1A, 5 (Pegasus)
  • zinc finger protein, subfamily 1A, 5
  • zinc finger transcription factor Pegasus
  • ZNFN1A5

Background

Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Pegasus, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP2-34099
Species: Hu
Applications: IHC, IHC-P
MAB73091
Species: Hu
Applications: WB, IHC
NBP2-55305
Species: Hu
Applications: WB, ICC/IF
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00005555-P01
Species: Hu
NBP2-76966
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-183
Species: Hu
Applications: WB
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92457
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00064376-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for IKZF5 Partial Recombinant Protein (H00064376-Q01) (0)

There are no publications for IKZF5 Partial Recombinant Protein (H00064376-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKZF5 Partial Recombinant Protein (H00064376-Q01) (0)

There are no reviews for IKZF5 Partial Recombinant Protein (H00064376-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IKZF5 Partial Recombinant Protein (H00064376-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional IKZF5 Products

Bioinformatics Tool for IKZF5 Partial Recombinant Protein (H00064376-Q01)

Discover related pathways, diseases and genes to IKZF5 Partial Recombinant Protein (H00064376-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKZF5 Partial Recombinant Protein (H00064376-Q01)

Discover more about diseases related to IKZF5 Partial Recombinant Protein (H00064376-Q01).

Blogs on IKZF5

There are no specific blogs for IKZF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IKZF5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IKZF5