We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human IKK alpha GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human IKK alpha Protein [H00001147-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human IKK alpha GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 646-745 of Human IKK alpha

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CHUK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IKK alpha GST (N-Term) Protein

  • CHUK
  • conserved helix-loop-helix ubiquitous kinaseIKBKA
  • EC 2.7.11
  • EC 2.7.11.10
  • I-kappa-B kinase 1
  • I-kappa-B kinase alpha
  • IkappaB kinase
  • IkBKA
  • IkBKalpha
  • IKK alpha
  • IKK1
  • IKK1I-kappa-B kinase-alpha
  • IKK-A
  • IKKAIkB kinase alpha subunit
  • IKK-alphainhibitor of nuclear factor kappa-B kinase subunit alpha
  • NFKBIKA
  • NFKBIKAIKK-a kinase
  • Nuclear factor NFkappaB inhibitor kinase alpha
  • Nuclear factor NF-kappa-B inhibitor kinase alpha
  • TCF16
  • TCF-16
  • Transcription factor 16

Background

CHUK - conserved helix-loop-helix ubiquitous kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
MAB3199
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-58853
Species: Hu
Applications: IHC,  IHC-P, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
H00001147-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

There are no publications for IKK alpha Partial Recombinant Protein (H00001147-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

There are no reviews for IKK alpha Partial Recombinant Protein (H00001147-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IKK alpha Products

Research Areas for IKK alpha Partial Recombinant Protein (H00001147-Q01)

Find related products by research area.

Blogs on IKK alpha.

IKK alpha says "no" to NFk beta
The nuclear factor kappa B (NFkB) is a ubiquitous transcription factor essential for the activation of immune and inflammatory responses. NFkB activity is inhibited when it is associated with IkB proteins in the cell cytoplasm. IkB proteins are phosph...  Read full blog post.

Regulating Immune Response Pathways with IKK beta
IKK beta, also known as IKK2, activates the NFkB complex by phosphorylating the NFkB inhibitor, IkBa. Several transcript variants, some protein-coding and some not, have been found for IKKB. The Nuclear Factor-kappa B (NF-kB) family of transcription f...  Read full blog post.

IKK alpha: Roles in Development, B-cell Survival and ESC Differentiation
Inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK1 alpha) is a serine/threonine kinase that forms a complex with IKK beta and NEMO. It plays an essential role in embryonic skin development. Mice with low levels of IKKa show an increase in ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IKK alpha GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHUK