Home » IGSF8/CD316 » IGSF8 Antibodies » IGSF8/CD316 Antibody (1E4)

IGSF8/CD316 Antibody (1E4)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: IGSF8/CD316 Antibody (1E4) [H00093185-M01] - Detection limit for recombinant GST tagged IGSF8 is approximately 0.1ng/ml as a capture antibody.
Sandwich ELISA: IGSF8/CD316 Antibody (1E4) [H00093185-M01] - Detection limit for recombinant GST tagged IGSF8 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1E4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

IGSF8/CD316 Antibody (1E4) Summary

Immunogen
IGSF8 (AAH04108, 220 a.a. ~ 322 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT
Specificity
IGSF8 - immunoglobulin superfamily, member 8
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IGSF8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IGSF8/CD316 Antibody (1E4)

  • CD316 antigen
  • CD316
  • CD81P3
  • CD81P3LIR-D1
  • EWI2
  • EWI-2
  • EWI2CD81 partner 3
  • Glu-Trp-Ile EWI motif-containing protein 2
  • IGSF8
  • immunoglobulin superfamily, member 8
  • KCT4
  • KCT-4
  • Keratinocytes-associated transmembrane protein 4
  • PGRL
  • PGRLimmunoglobulin superfamily member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD9 Antibody
(MEM-61) - BSA Free
NB500-327
Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Staining of human peripheral blood with anti-CD9 (MEM-61) APC.
Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Staining of human peripheral blood with anti-CD9 (MEM-61) PE.
Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Staining of human peripheral blood with anti-CD9 (MEM-61) Alexa Fluor® 647.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
CD81 Antibody
(1D6) - BSA Free
NB100-65805
Flow Cytometry: CD81 Antibody (1D6) [NB100-65805] - A surface stain was performed on Jurkat Cells with CD81 Antibody (1D6) NB100-65805B and a matched isotype control. Both antibodies were conjugated to biotin. Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Flow Cytometry: CD81 Antibody (1D6) [NB100-65805] - A surface stain was performed on Jurkat cells with CD81 Antibody [1D6] NB100-65805AF488 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Western Blot: CD81 Antibody (1D6) [NB100-65805] - Isolation and characterization of exosomes from cell culture supernatant and human blood. Immunoblot of exosomal markers CD81 (~30 kDa), CD63 (~55 kDa), and LAMP2B (~50 kDa) in exosomes (5 ug lysates) isolated from the serum of breast cancer patients and healthy control. Grp94 (~100 kDa) and beta-actin (~42 kDa) serve as a negative control and a loading control, respectively. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep36502), licensed under a CC-BY licence.
(1 Review)
(19 Publications)
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB

TACI/TNFRSF13B/CVID An
NB100-56516
Western Blot: TACI/TNFRSF13B/CVID Antibody [NB100-56516] - Analysis of A) human spleen, B) mouse spleen, C) human stomach, D) and mouse stomach lysate using TACI antibody at 2 ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
B7-H2/ICOSLG
Antibody [Unconjugate
AF165
U937 human histiocytic lymphoma cell line was stained with Goat Anti-HumanB7‑H2 Antigen Affinity‑purified Polyclonal Anti­body (Catalog # AF165, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
Western blot shows lysate of U937 human histiocytic lymphoma cell line. PVDF membrane was probed with 2 µg/mL of Goat Anti-Human B7‑H2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF165) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for B7‑H2 at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
BAFFR/TNFRSF13C
Antibody [Unconjugate
AF1162
Recombinant Human BAFF R/TNFRSF13C Fc Chimera (Catalog #1162‑BR) inhibits Recombinant Human BAFF/BLyS/TNFSF13B (Catalog # 2149‑BF) induced proliferation in mouse B cells in a dose-dependent manner (orange line). Inhibition of Recombinant Human BAFF/BLyS/TNFSF13B (5 ng/mL) activity elicited by Recombinant Human BAFF R/TNFRSF13C Fc Chimera (0.3 µg/mL) is neutralized (green line) by increasing concentrations of Goat Anti‑Human BAFF R/TNFRSF13C Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1162). The ND50 is typically3-15 µg/mL.
BAFF R/TNFRSF13C was detected in immersion fixed paraffin-embedded sections of human spleen using Goat Anti-Human BAFF R/TNFRSF13C Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1162) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane and cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Peripheral blood mononuclear cells (PBMCs) were stained with Mouse Anti-Human CD19 Fluorescein‑conjugated Monoclonal Antibody (Catalog # FAB4867F) and either (A) Goat Anti-Human BAFF R/TNFRSF13C Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1162) or (B) Normal Goat IgG Control (Catalog # AB-108-C) followed by APC-conjugated anti-goat secondary antibody (Catalog # F0108). View our protocol for Staining Membrane-associated Proteins. 
(12 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
OX40 Ligand/TNFSF4
Antibody (159403) [Un ...
MAB10541
OX40 Ligand/TNFSF4 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) stimulated with LPS using Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody (Catalog # MAB10541) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (orange; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Human mature dentritic cells differentated from human peripheral blood mononuclear cell derived CD14+ cells treated with 20 ng/mL Recombinant Human IL‑4 (Catalog # 204-IL) and 50 ng/mL Recombinant Human GM‑CSF (Catalog # 215-GM) for 7 days and 1 μg/mL LPS, 20 ng/mL Recombinant Human TNF‑ alpha (Catalog # 210-TA), and 20 ng/mL Recombinant Human IL‑1 beta /IL‑1F2 (Catalog # 201-LB) for last 24 hours were stained with Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody(Catalog # MAB10541, filled histogram) or isotype control (Catalog # MAB002, open histogram), followed by Goat F(ab)2 Anti-Mouse IgG (H+L) Allophycocyanin (Catalog # F0101B).
Recombinant Human OX40 Ligand/TNFSF4 (Catalog # 1054-OX) induces IL‑8 secretion in the HT1080 human fibrosarcoma cell line transfected with human OX40 in a dose-dependent manner (orange line) as measured by Human IL‑8 Duoset (Catalog # DY208). IL‑8 Secretion elicited by Recombinant Human OX40 Ligand/TNFSF4 (10 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody (Catalog # MAB10541). The ND50 is typically 0.1-0.6  μg/mL.
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut

TRANCE/TNFSF11/RANK L
462-TR/CF
1 μg/lane of Recombinant Mouse TRANCE/TNFSF11/RANK L was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 36 kDa.
Recombinant Mouse TRANCE/TNFSF11/RANK L (Catalog # 462-TR/CF) induces osteoclast differentiation of the RAW 264.7 mouse monocyte/macrophage cell line. The ED50 for this effect is 5-15 ng/mL in the presence of 2.5 μg/mL of a cross-linking antibody, Mouse Anti-polyHistidine Monoclonal Antibody (Catalog # MAB050)
(83 Publications)
Species: Mu
Applications: BA
CD82/Kai-1
Antibody (C33) - BSA
NBP2-21792
Flow Cytometry: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Staining of CD82 on human peripheral blood cells with anti-CD82 (C33) APC.
Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Staining of human tonsil (paraffin-embedded sections) with anti-CD82 (C33).
Flow Cytometry: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Flow Cytometry: [PerCP] [NBP2-21792PCP] - A cell surface (A) and intracellular stain (B) was performed on Daudi cells with CD82/Kai-1 (C33) antibody NBP2-21792PCP along with a matched isotype control NB600-986PCP. The cell surface stain was performed in an antibody dilution of 5 ug/mL and incubated at RT for 20 minutes. Prior to intracellular staining, the cells were fixed with 4% PFA and then permeablized with 0.1 % saponin. The cells were then incubated in an antibody dilution of 5 ug/mL at RT for 30 minutes. Both antibodies were conjugated to Peridinin-Chlorophyll-Protein complex. Image using the PerCP form of this antibody.
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
TSPAN7/TM4SF2
Antibody
NBP1-90310
Western Blot: TSPAN7/TM4SF2 Antibody [NBP1-90310] - Analysis in control (vector only transfected HEK293T lysate) and tSPAN7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody [NBP1-90310] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
FCRL5/FcRH5/IRTA2
Antibody
AF2087
CD19+ human peripheral blood mononuclear cell (PBMC) lymphocytes were stained with Goat Anti-Human FCRL5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2087, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, WB
FPRP/PTGFRN
Antibody [Unconjugate
AF4495
3T3‑L1 mouse embryonic fibroblast adipose‑like cell line was stained with Sheep Anti-Mouse FPRP/PTGFRN Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4495, filled histogram) or isotype control antibody (Catalog # 5-001-A, open histogram), followed by Northern­Lights™ 637-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL011).
Species: Mu
Applications: CyTOF-ready, Flow, WB
BCMA/TNFRSF17
Antibody [Unconjugate
AF193
U266 human myeloma cell line was stained with Goat Anti-Human/Primate BCMA/TNFRSF17 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF193, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(1 Review)
(6 Publications)
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ELISA(Sta), ELISA, Flow, WB
BST2 Antibody
(120G8.04)
DDX0390P-100
Immunocytochemistry/Immunofluorescence: BST2 Antibody (120G8.04) [DDX0390P-100] - Murine peyer patch: BST-2
Immunohistochemistry: BST2 Antibody (120G8.04) [DDX0390P-100] - IHC staining of murine spleen cryosections
Flow Cytometry: BST2 Antibody (120G8.04) [DDX0390P-100] - Facs sorting of mouse PDCs (120G8/CD11c)
(63 Publications)
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
IGSF2/CD101
Antibody (307707)
MAB3368
IGSF2/CD101 Antibody (307707)
(1 Publication)
Species: Mu
Applications: CyTOF-ready, Flow
IGSF8/CD316
Antibody (1E4)
H00093185-M01
IGSF8/CD316 Antibody (1E4)
Species: Hu
Applications: ELISA, S-ELISA

Publications for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no publications for IGSF8/CD316 Antibody (H00093185-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no reviews for IGSF8/CD316 Antibody (H00093185-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF8/CD316 Products

Bioinformatics Tool for IGSF8/CD316 Antibody (H00093185-M01)

Discover related pathways, diseases and genes to IGSF8/CD316 Antibody (H00093185-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF8/CD316 Antibody (H00093185-M01)

Discover more about diseases related to IGSF8/CD316 Antibody (H00093185-M01).
 

Pathways for IGSF8/CD316 Antibody (H00093185-M01)

View related products by pathway.

PTMs for IGSF8/CD316 Antibody (H00093185-M01)

Learn more about PTMs related to IGSF8/CD316 Antibody (H00093185-M01).
 

Research Areas for IGSF8/CD316 Antibody (H00093185-M01)

Find related products by research area.

Blogs on IGSF8/CD316

There are no specific blogs for IGSF8/CD316, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF8/CD316 Antibody (1E4) and receive a gift card or discount.


Bioinformatics

Gene Symbol IGSF8
Entrez
OMIM
Uniprot