IGSF8/CD316 Antibody (1E4)

Images

 
Sandwich ELISA: IGSF8/CD316 Antibody (1E4) [H00093185-M01] - Detection limit for recombinant GST tagged IGSF8 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1E4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IGSF8/CD316 Antibody (1E4) Summary

Immunogen
IGSF8 (AAH04108, 220 a.a. ~ 322 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT
Specificity
IGSF8 - immunoglobulin superfamily, member 8
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IGSF8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IGSF8/CD316 Antibody (1E4)

  • CD316 antigen
  • CD316
  • CD81P3
  • CD81P3LIR-D1
  • EWI2
  • EWI-2
  • EWI2CD81 partner 3
  • Glu-Trp-Ile EWI motif-containing protein 2
  • IGSF8
  • immunoglobulin superfamily, member 8
  • KCT4
  • KCT-4
  • Keratinocytes-associated transmembrane protein 4
  • PGRL
  • PGRLimmunoglobulin superfamily member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB500-327
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, In vitro, CyTOF-ready
NB100-65805
Species: Hu, Mu, Gt, Pm, Sh
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56516
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1162
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP2-21792
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
AF2087
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF4495
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-97637
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
DDX0390P-100
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, B/N, IHC-FrFl
MAB3368
Species: Mu
Applications: Flow, CyTOF-ready
H00093185-M01
Species: Hu
Applications: ELISA, S-ELISA

Publications for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no publications for IGSF8/CD316 Antibody (H00093185-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no reviews for IGSF8/CD316 Antibody (H00093185-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IGSF8/CD316 Products

Bioinformatics Tool for IGSF8/CD316 Antibody (H00093185-M01)

Discover related pathways, diseases and genes to IGSF8/CD316 Antibody (H00093185-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF8/CD316 Antibody (H00093185-M01)

Discover more about diseases related to IGSF8/CD316 Antibody (H00093185-M01).
 

Pathways for IGSF8/CD316 Antibody (H00093185-M01)

View related products by pathway.

PTMs for IGSF8/CD316 Antibody (H00093185-M01)

Learn more about PTMs related to IGSF8/CD316 Antibody (H00093185-M01).
 

Research Areas for IGSF8/CD316 Antibody (H00093185-M01)

Find related products by research area.

Blogs on IGSF8/CD316

There are no specific blogs for IGSF8/CD316, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF8/CD316 Antibody (1E4) and receive a gift card or discount.

Bioinformatics

Gene Symbol IGSF8
Entrez
OMIM
Uniprot