Home » IGSF8/CD316 » IGSF8 Antibodies » IGSF8/CD316 Antibody (1E4)

IGSF8/CD316 Antibody (1E4)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: IGSF8/CD316 Antibody (1E4) [H00093185-M01] - Detection limit for recombinant GST tagged IGSF8 is approximately 0.1ng/ml as a capture antibody.
Sandwich ELISA: IGSF8/CD316 Antibody (1E4) [H00093185-M01] - Detection limit for recombinant GST tagged IGSF8 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1E4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

IGSF8/CD316 Antibody (1E4) Summary

Immunogen
IGSF8 (AAH04108, 220 a.a. ~ 322 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT
Specificity
IGSF8 - immunoglobulin superfamily, member 8
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IGSF8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IGSF8/CD316 Antibody (1E4)

  • CD316 antigen
  • CD316
  • CD81P3
  • CD81P3LIR-D1
  • EWI2
  • EWI-2
  • EWI2CD81 partner 3
  • Glu-Trp-Ile EWI motif-containing protein 2
  • IGSF8
  • immunoglobulin superfamily, member 8
  • KCT4
  • KCT-4
  • Keratinocytes-associated transmembrane protein 4
  • PGRL
  • PGRLimmunoglobulin superfamily member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
CD9 Antibody
(MEM-61)
NB500-327
Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Staining of human peripheral blood with anti-CD9 (MEM-61) Alexa Fluor® 647.
Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Surface staining of NALM-6 human pre-B cell leukemia cell line Total viable cells were used for analysis.
Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Surface staining (mass cytometry) of PBMC after Ficoll-Paque separation with anti-human CD9 (MEM-61) Dy161.
(9 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, In vitro, CyTOF-ready
CD81 Antibody (1D6)
NB100-65805
Western Blot: CD81 Antibody (1D6) [NB100-65805] - Isolation and characterization of exosomes from cell culture supernatant and human blood. Immunoblot of exosomal markers CD81 (~30 kDa), CD63 (~55 kDa), and LAMP2B (~50 kDa) in exosomes (5 ug lysates) isolated from the serum of breast cancer patients and healthy control. Grp94 (~100 kDa) and beta-actin (~42 kDa) serve as a negative control and a loading control, respectively. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep36502), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: CD81 Antibody (1D6) [NB100-65805] - The TAPA1 Antibody (1D6) was tested in A431 cells at a 1:10 dilution against DyLight 488 (green). Actin was counterstained against Phalloidin 568 (red) and cells were mounted in DAPI Flouromount (blue).
Immunohistochemistry-Paraffin: CD81 Antibody (1D6) [NB100-65805] - Staining of TAPA1 in human testis using DAB with hematoxylin counterstain.
(1 Review)
(9 Publications)
Species: Hu, Mu, Gt, Pm, Sh
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

TACI/TNFRSF13B/CVID An
NB100-56516
Western Blot: TACI/TNFRSF13B/CVID Antibody [NB100-56516] - Analysis of A) human spleen, B) mouse spleen, C) human stomach, D) and mouse stomach lysate using TACI antibody at 2 ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
B7-H2/ICOSLG
[Unconjugated]
165-B7
Recombinant Human B7‑H2 Fc Chimera (Catalog # 165-B7) stimulates human T cellproliferation in the presence of anti-CD3. The ED50 for this effectis 0.3‑1.2 µg/mL in the presence of anti-CD3 immobilized at leastat 20 ng/mL.
(1 Review)
(4 Publications)
Species: Hu
BAFFR/TNFRSF13C
Antibody [Unconjugate
AF1162
Recombinant Human BAFF R/TNFRSF13C Fc Chimera (Catalog #1162‑BR) inhibits Recombinant Human BAFF/BLyS/TNFSF13B (Catalog # 2149‑BF) induced proliferation in mouse B cells in a dose-dependent manner (orange line). Inhibition of Recombinant Human BAFF/BLyS/TNFSF13B (5 ng/mL) activity elicited by Recombinant Human BAFF R/TNFRSF13C Fc Chimera (0.3 µg/mL) is neutralized (green line) by increasing concentrations of Goat Anti‑Human BAFF R/TNFRSF13C Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1162). The ND50 is typically3-15 µg/mL.
BAFF R/TNFRSF13C was detected in immersion fixed paraffin-embedded sections of human spleen using Goat Anti-Human BAFF R/TNFRSF13C Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1162) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane and cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Peripheral blood mononuclear cells (PBMCs) were stained with Mouse Anti-Human CD19 Fluorescein‑conjugated Monoclonal Antibody (Catalog # FAB4867F) and either (A) Goat Anti-Human BAFF R/TNFRSF13C Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1162) or (B) Normal Goat IgG Control (Catalog # AB-108-C) followed by APC-conjugated anti-goat secondary antibody (Catalog # F0108). View our protocol for Staining Membrane-associated Proteins. 
(12 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
OX40 Ligand/TNFSF4
Antibody (159403) [Un ...
MAB10541
OX40 Ligand/TNFSF4 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) stimulated with LPS using Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody (Catalog # MAB10541) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (orange; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Human mature dentritic cells differentated from human peripheral blood mononuclear cell derived CD14+ cells treated with 20 ng/mL Recombinant Human IL‑4 (Catalog # 204-IL) and 50 ng/mL Recombinant Human GM‑CSF (Catalog # 215-GM) for 7 days and 1 μg/mL LPS, 20 ng/mL Recombinant Human TNF‑ alpha (Catalog # 210-TA), and 20 ng/mL Recombinant Human IL‑1 beta /IL‑1F2 (Catalog # 201-LB) for last 24 hours were stained with Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody(Catalog # MAB10541, filled histogram) or isotype control (Catalog # MAB002, open histogram), followed by Goat F(ab)2 Anti-Mouse IgG (H+L) Allophycocyanin (Catalog # F0101B).
Recombinant Human OX40 Ligand/TNFSF4 (Catalog # 1054-OX) induces IL‑8 secretion in the HT1080 human fibrosarcoma cell line transfected with human OX40 in a dose-dependent manner (orange line) as measured by Human IL‑8 Duoset (Catalog # DY208). IL‑8 Secretion elicited by Recombinant Human OX40 Ligand/TNFSF4 (10 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody (Catalog # MAB10541). The ND50 is typically 0.1-0.6  μg/mL.
(5 Publications)
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut

TRANCE/TNFSF11/RANK L
462-TR
1 μg/lane of Recombinant Mouse TRANCE/TNFSF11/RANK L was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 36 kDa.
Recombinant Mouse TRANCE/TNFSF11/RANK L (Catalog # 462-TR) induces osteoclast differentiation of the RAW 264.7 mouse monocyte/macrophage cell line. The ED50 for this effect is 5‑15 ng/mL in the presence of 2.5 μg/mL of a cross-linking antibody, Mouse Anti-polyHistidine Monoclonal Antibody (Catalog # MAB050)
(77 Publications)
Species: Mu
CD82/Kai-1
Antibody (C33)
NBP2-21792
Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Staining of human tonsil (paraffin-embedded sections) with anti-CD82 (C33).
Flow Cytometry: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Analysis (surface staining) of CD82 on human peripheral blood cells with anti-CD82 (C33) PE.
Flow Cytometry: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Staining of CD82 on human peripheral blood cells with anti-CD82 (C33) APC.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
TSPAN7/TM4SF2
Antibody
NBP1-90310
Western Blot: TSPAN7/TM4SF2 Antibody [NBP1-90310] - Analysis in control (vector only transfected HEK293T lysate) and tSPAN7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody [NBP1-90310] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
FCRL5/FcRH5/IRTA2
Antibody
AF2087
CD19+ human peripheral blood mononuclear cell (PBMC) lymphocytes were stained with Goat Anti-Human FCRL5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2087, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(1 Review)
Species: Hu
Applications: WB, Flow, CyTOF-ready
FPRP/PTGFRN
Antibody [Unconjugate
AF4495
3T3‑L1 mouse embryonic fibroblast adipose‑like cell line was stained with Sheep Anti-Mouse FPRP/PTGFRN Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4495, filled histogram) or isotype control antibody (Catalog # 5-001-A, open histogram), followed by Northern­Lights™ 637-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL011).
Species: Mu
Applications: WB, Flow, CyTOF-ready
BCMA/TNFRSF17
Antibody (Vicky-1)
NBP1-97637
Immunohistochemistry: BCMA/TNFRSF17 Antibody (Vicky-1) [NBP1-97637] - Immunostaining of HEK 293 cells transfected with a human BCMA expression plasmid (left panel), or mock transfected (right panel). Method: 3 days after transfection of cells with the indicated constructs, cells were fixed with acetone or 4% formaldehyde for 5 min. at room temperature. Slides were blocked with normal IgG, and incubated for 1 hour with 5ug/ml MAb to BCMA (human) (Vicky-1) in 1% BSA in 1x PBS. After washes in PBS, samples were incubated with the secondary antibody for 1 hour, washed in PBS and revealed with StreptABComplex/HRP (Vector) and AEC.
Flow Cytometry: BCMA/TNFRSF17 Antibody (Vicky-1) [NBP1-97637] - Analysis using the PE conjugate of NBP1-97637. Staining of 10^6 U266 cells using BCMA (human), mAb (Vicky-1) (PE conjugate) at a concentration of 10ug/ml.
Flow Cytometry: BCMA/TNFRSF17 Antibody (Vicky-1) [NBP1-97637] - Detection of endogenous human BCMA with MAb to BCMA (human) (Vicky-1). Method: U266 cells (2x10^5) were incubated on ice for 30 min. with 0.2ug of MAb to BCMA (human) (Vicky-1) or an isotype control in 25ul FACS buffer (PBS, 5% fetal calf serum, 0.02% azide). The primary antibody was revealed with PAb to Rat IgG (R-PE) and then analyzed by flow cytometry.
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
BST2 Antibody
(120G8.04)
DDX0390P-100
Immunocytochemistry/Immunofluorescence: BST2 Antibody (120G8.04) [DDX0390P-100] - Murine peyer patch: BST-2
Immunohistochemistry: BST2 Antibody (120G8.04) [DDX0390P-100] - IHC staining of murine spleen cryosections
Flow Cytometry: BST2 Antibody (120G8.04) [DDX0390P-100] - In vivo depletion of mouse PDCs (gated on CD11c+CD3- cells).
(63 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, B/N, IHC-FrFl
IGSF2/CD101
Antibody (307707)
MAB3368
IGSF2/CD101 Antibody (307707)
Species: Mu
Applications: Flow, CyTOF-ready
IGSF8/CD316
Antibody (1E4)
H00093185-M01
IGSF8/CD316 Antibody (1E4)
Species: Hu
Applications: ELISA, S-ELISA

Publications for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no publications for IGSF8/CD316 Antibody (H00093185-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no reviews for IGSF8/CD316 Antibody (H00093185-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGSF8/CD316 Antibody (H00093185-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional IGSF8/CD316 Products

Bioinformatics Tool for IGSF8/CD316 Antibody (H00093185-M01)

Discover related pathways, diseases and genes to IGSF8/CD316 Antibody (H00093185-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF8/CD316 Antibody (H00093185-M01)

Discover more about diseases related to IGSF8/CD316 Antibody (H00093185-M01).
 

Pathways for IGSF8/CD316 Antibody (H00093185-M01)

View related products by pathway.

PTMs for IGSF8/CD316 Antibody (H00093185-M01)

Learn more about PTMs related to IGSF8/CD316 Antibody (H00093185-M01).
 

Research Areas for IGSF8/CD316 Antibody (H00093185-M01)

Find related products by research area.

Blogs on IGSF8/CD316

There are no specific blogs for IGSF8/CD316, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF8/CD316 Antibody (1E4) and receive a gift card or discount.


Bioinformatics

Gene Symbol IGSF8
Entrez
OMIM
Uniprot