IFT88 Antibody (6P4S5)

Western Blot: IFT88 Antibody (6P4S5) [NBP3-33370] - Western blot analysis of various lysates, using IFT88 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 6P4S5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

IFT88 Antibody (6P4S5) Summary

• Description: Novus Biologicals Rabbit IFT88 Antibody (6P4S5) (NBP3-33370) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 534-833 of human IFT88 (NP_783195.2).
  
  Sequence:
  GLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDREGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: IFT88
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 93 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for IFT88 Antibody (6P4S5)

• D13S1056ETPR repeat protein 10
• DAF19
• hTg737
• intraflagellar transport 88 homolog (Chlamydomonas)
• intraflagellar transport protein 88 homolog
• MGC26259
• polaris homolog
• probe hTg737 (polycystic kidney disease, autosomal recessive)
• Recessive polycystic kidney disease protein Tg737 homolog
• tetratricopeptide repeat domain 10
• Tetratricopeptide repeat protein 10
• TG737Tg737
• TTC10

Background

IFT88 encodes a member of the tetratrico peptide repeat (TPR) family. Mutations of a similar gene in mouse can cause polycystic kidney disease. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFT88