Recombinant Human IFT74 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IFT74 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human CCDC2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEEVMNGYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSLENQVKYLEMKTTNEKLLQELDTLQQQLDSQNMKKESLEAEI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
IFT74

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFT74 Protein

  • Capillary morphogenesis gene 1 protein
  • CCDC2capillary morphogenesis protein 1
  • CMG1Coiled-coil domain-containing protein 2
  • CMG-1MGC111562
  • coiled-coil domain containing 2
  • FLJ22621
  • intraflagellar transport 74 homolog (Chlamydomonas)
  • intraflagellar transport protein 74 homolog

Background

IFT74 - coiled-coil domain containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NBP1-82474
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90686
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-55756
Species: Hu
Applications: IHC-P
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
H00080173-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IFT74 Partial Recombinant Protein (H00080173-Q01) (0)

There are no publications for IFT74 Partial Recombinant Protein (H00080173-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFT74 Partial Recombinant Protein (H00080173-Q01) (0)

There are no reviews for IFT74 Partial Recombinant Protein (H00080173-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFT74 Partial Recombinant Protein (H00080173-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFT74 Products

Bioinformatics Tool for IFT74 Partial Recombinant Protein (H00080173-Q01)

Discover related pathways, diseases and genes to IFT74 Partial Recombinant Protein (H00080173-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFT74 Partial Recombinant Protein (H00080173-Q01)

Discover more about diseases related to IFT74 Partial Recombinant Protein (H00080173-Q01).
 

Pathways for IFT74 Partial Recombinant Protein (H00080173-Q01)

View related products by pathway.

Blogs on IFT74

There are no specific blogs for IFT74, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IFT74 Antibody
NB300-822

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IFT74 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT74