IFN-gamma R1/CD119 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFN-gamma R1/CD119. Source: E. coli
Amino Acid Sequence: SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
IFNGR1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49406. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for IFN-gamma R1/CD119 Recombinant Protein Antigen
Background
IFN gamma receptor beta is part of the receptor for interferon gamma. This class II cytokine receptor pairs with CDw119 to form the IFN gamma receptor and is an integral part of the IFN gamma signal transduction pathway. CDw119 serves as the IFN gamma binding chain and associates with the IFN gamma beta chain which is required for receptor signaling. The extracellular portion of both the IFN gamma receptor alpha and beta chains must be species matched. The IFN gamma receptor beta chain is expressed on T and B cells, NK cells, monocytes/ macrophages, and fibroblasts. Binding of IFN gamma induces receptor dimerization, internalization, Jak1 and Jak2 protein kinase activation and, ultimately, STAT1 activation. It is also likely to interact with GAF. IFN gamma initiates and regulates a variety of immune responses and is required for signal transduction. Contains 2 fibronectin type III domains. Defects in IFN gamma Receptor beta are a cause of mendelian susceptibility to mycobacterial disease (MSMD), a rare condition that confers predisposition to illness caused by several mycobacteria strains.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: AC
Publications for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP) (0)
There are no publications for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP) (0)
There are no reviews for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP) (0)
Additional IFN-gamma R1/CD119 Products
Research Areas for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP)
Find related products by research area.
|
Blogs on IFN-gamma R1/CD119