IFN-gamma R1/CD119 Recombinant Protein Antigen

Images

 
There are currently no images for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IFN-gamma R1/CD119 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFN-gamma R1/CD119.

Source: E. coli

Amino Acid Sequence: SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IFNGR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49406.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IFN-gamma R1/CD119 Recombinant Protein Antigen

  • AVP, type 2
  • CD119 antigen
  • CD119
  • FLJ45734
  • IFN-gamma R1
  • IFN-gamma receptor 1
  • IFNgammaR1
  • IFN-gamma-R1
  • IFNGR
  • IFNGR1
  • IFN-gR1
  • immune interferon receptor 1
  • interferon gamma receptor 1
  • interferon-gamma receptor alpha chain
  • type 2

Background

IFN gamma receptor beta is part of the receptor for interferon gamma. This class II cytokine receptor pairs with CDw119 to form the IFN gamma receptor and is an integral part of the IFN gamma signal transduction pathway. CDw119 serves as the IFN gamma binding chain and associates with the IFN gamma beta chain which is required for receptor signaling. The extracellular portion of both the IFN gamma receptor alpha and beta chains must be species matched. The IFN gamma receptor beta chain is expressed on T and B cells, NK cells, monocytes/ macrophages, and fibroblasts. Binding of IFN gamma induces receptor dimerization, internalization, Jak1 and Jak2 protein kinase activation and, ultimately, STAT1 activation. It is also likely to interact with GAF. IFN gamma initiates and regulates a variety of immune responses and is required for signal transduction. Contains 2 fibronectin type III domains. Defects in IFN gamma Receptor beta are a cause of mendelian susceptibility to mycobacterial disease (MSMD), a rare condition that confers predisposition to illness caused by several mycobacteria strains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

485-MI
Species: Mu
Applications: BA
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
AF773
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
M6000B
Species: Mu
Applications: ELISA
AF839
Species: Hu
Applications: WB
6507-IL/CF
Species: Hu
Applications: BA
DY499
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-75547
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
201-LB
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP) (0)

There are no publications for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP) (0)

There are no reviews for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFN-gamma R1/CD119 Products

Research Areas for IFN-gamma R1/CD119 Recombinant Protein Antigen (NBP2-49406PEP)

Find related products by research area.

Blogs on IFN-gamma R1/CD119

There are no specific blogs for IFN-gamma R1/CD119, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IFN-gamma R1/CD119 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNGR1