IFN-alpha J1/IFNA7 Antibody

Images

 
Western Blot: IFNA7 Antibody [NBP1-79586] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

IFN-alpha J1/IFNA7 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the N terminal of human IFNA7The immunogen for this antibody is IFNA7. Peptide sequence RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFNA7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for IFN-alpha J1/IFNA7 Antibody

  • IFNA7
  • IFN-alpha 7
  • IFNalpha J1
  • IFN-alpha J1
  • interferon alpha-7
  • interferon alpha-J1
  • interferon, alpha 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

12105-1
Species: Mu
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP3-06987
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
8499-IF
Species: Hu
Applications: BA
MAB5285
Species: Hu
Applications: Simple Western, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-84174
Species: Hu
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
AF5366
Species: Hu, Mu, Rt
Applications: Simple Western, WB
DRN00B
Species: Hu
Applications: ELISA
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF4715
Species: Mu
Applications: WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4019
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
11145-1
Species: Hu
Applications: BA
H00003447-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP1-79586
Species: Hu
Applications: WB

Publications for IFN-alpha J1/IFNA7 Antibody (NBP1-79586) (0)

There are no publications for IFN-alpha J1/IFNA7 Antibody (NBP1-79586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha J1/IFNA7 Antibody (NBP1-79586) (0)

There are no reviews for IFN-alpha J1/IFNA7 Antibody (NBP1-79586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha J1/IFNA7 Antibody (NBP1-79586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-alpha J1/IFNA7 Products

Pathways for IFN-alpha J1/IFNA7 Antibody (NBP1-79586)

View related products by pathway.

Research Areas for IFN-alpha J1/IFNA7 Antibody (NBP1-79586)

Find related products by research area.

Blogs on IFN-alpha J1/IFNA7

There are no specific blogs for IFN-alpha J1/IFNA7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha J1/IFNA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA7
Uniprot