IFN-alpha F/IFNA21 Antibody

Images

 
Western Blot: IFN-alpha F/IFNA21 Antibody [H00003452-D01P] - Analysis of IFNA21 expression in transfected 293T cell line by IFNA21 polyclonal antibody.Lane 1: IFNA21 transfected lysate(21.70 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFN-alpha F/IFNA21 Antibody Summary

Immunogen
IFNA21 (AAH69329.1, 1 a.a. - 189 a.a.) full-length human protein. MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Specificity
Reacts with interferon, alpha 21.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFNA21
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-alpha F/IFNA21 Antibody

  • IFNA21
  • IFNalpha F
  • IFN-alpha F
  • IFN-alpha-21
  • IFN-alphaI
  • interferon alpha-21
  • Interferon alpha-F
  • interferon, alpha 21
  • LeIF F
  • leukocyte interferon protein
  • MGC126687
  • MGC126689

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81018
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF1083
Species: Mu
Applications: WB, Neut
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for IFN-alpha F/IFNA21 Antibody (H00003452-D01P) (0)

There are no publications for IFN-alpha F/IFNA21 Antibody (H00003452-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha F/IFNA21 Antibody (H00003452-D01P) (0)

There are no reviews for IFN-alpha F/IFNA21 Antibody (H00003452-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha F/IFNA21 Antibody (H00003452-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-alpha F/IFNA21 Products

Bioinformatics Tool for IFN-alpha F/IFNA21 Antibody (H00003452-D01P)

Discover related pathways, diseases and genes to IFN-alpha F/IFNA21 Antibody (H00003452-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-alpha F/IFNA21 Antibody (H00003452-D01P)

Discover more about diseases related to IFN-alpha F/IFNA21 Antibody (H00003452-D01P).
 

Pathways for IFN-alpha F/IFNA21 Antibody (H00003452-D01P)

View related products by pathway.

Blogs on IFN-alpha F/IFNA21

There are no specific blogs for IFN-alpha F/IFNA21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha F/IFNA21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA21
Entrez
Uniprot