IFN-alpha 2 Antibody

Images

 
Western Blot: IFN-alpha 2 Antibody [H00003440-B01P] - Analysis of IFNA2 expression in transfected 293T cell line by IFNA2 polyclonal antibody. Lane 1: IFNA2 transfected lysate(20.68 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFN-alpha 2 Antibody Summary

Immunogen
IFNA2 (NP_000596, 1 a.a. - 188 a.a.) full-length human protein. MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IFNA2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-alpha 2 Antibody

  • alpha-2a interferon
  • Ifa2
  • IFNA
  • IFNA2
  • IFNA2a
  • IFNA2b
  • IFNA2c
  • IFNAA
  • IFNalpha 2
  • IFN-alpha 2
  • IFN-alpha-2
  • IFN-alphaA
  • INFA2
  • interferon alpha 2b
  • interferon alpha A
  • interferon alpha-2
  • Interferon alpha-A
  • interferon, alpha 2
  • LeIF A
  • MGC125764
  • MGC125765

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-67634
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00003447-M03
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-67741
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-31207
Species: Hu, Mu, Rt, Po, Sq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4715
Species: Mu
Applications: WB
NB100-1092
Species: Hu, Mu
Applications: WB, ChIP, Flow, PEP-ELISA
NB600-326
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for IFN-alpha 2 Antibody (H00003440-B01P) (0)

There are no publications for IFN-alpha 2 Antibody (H00003440-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha 2 Antibody (H00003440-B01P) (0)

There are no reviews for IFN-alpha 2 Antibody (H00003440-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha 2 Antibody (H00003440-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IFN-alpha 2 Products

Bioinformatics Tool for IFN-alpha 2 Antibody (H00003440-B01P)

Discover related pathways, diseases and genes to IFN-alpha 2 Antibody (H00003440-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-alpha 2 Antibody (H00003440-B01P)

Discover more about diseases related to IFN-alpha 2 Antibody (H00003440-B01P).
 

Pathways for IFN-alpha 2 Antibody (H00003440-B01P)

View related products by pathway.

PTMs for IFN-alpha 2 Antibody (H00003440-B01P)

Learn more about PTMs related to IFN-alpha 2 Antibody (H00003440-B01P).
 

Research Areas for IFN-alpha 2 Antibody (H00003440-B01P)

Find related products by research area.

Blogs on IFN-alpha 2

There are no specific blogs for IFN-alpha 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA2
Uniprot