IFN-alpha 13 Antibody

Images

 
Western Blot: IFN-alpha 13 Antibody [NBP1-74124] - Titration: 1.0 ug/ml Positive Control: Placenta.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFN-alpha 13 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of IFNA13. Immunizing peptide sequence ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFNA13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IFNA13 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IFN-alpha 13 Antibody

  • IFL
  • IFNA1
  • IFNA13
  • IFNalpha 13
  • IFN-alpha 13
  • IFN-alpha 1b
  • IFN-alpha-1/13
  • interferon alpha-1/13
  • Interferon alpha-D
  • interferon, alpha 13
  • LeIF D

Background

IFNA13 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4715
Species: Mu
Applications: WB
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for IFN-alpha 13 Antibody (NBP1-74124) (0)

There are no publications for IFN-alpha 13 Antibody (NBP1-74124).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha 13 Antibody (NBP1-74124) (0)

There are no reviews for IFN-alpha 13 Antibody (NBP1-74124). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha 13 Antibody (NBP1-74124) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-alpha 13 Products

Bioinformatics Tool for IFN-alpha 13 Antibody (NBP1-74124)

Discover related pathways, diseases and genes to IFN-alpha 13 Antibody (NBP1-74124). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-alpha 13 Antibody (NBP1-74124)

Discover more about diseases related to IFN-alpha 13 Antibody (NBP1-74124).
 

Pathways for IFN-alpha 13 Antibody (NBP1-74124)

View related products by pathway.

Blogs on IFN-alpha 13

There are no specific blogs for IFN-alpha 13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha 13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA13
Entrez
Uniprot