Home » ICMT » ICMT Proteins » ICMT Recombinant Protein Antigen

ICMT Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ICMT Recombinant Protein Antigen (NBP2-38198PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ICMT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICMT.

Source: E.coli

Amino Acid Sequence: RKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRH
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ICMT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38198. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ICMT Recombinant Protein Antigen

  • EC 2.1.1.100
  • HSTE14
  • ICMT
  • Isoprenylcysteine Carboxyl Methyltransferase
  • Isoprenylcysteine carboxylmethyltransferase
  • MST098
  • MSTP098
  • pcCMT
  • PCMT
  • PPMT
  • Prenylated Protein Carboxyl Methyltransferase
  • Protein-S-Isoprenylcysteine O-Methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RCE1 Antibody
NBP1-59922
Western Blot: RCE1 Antibody [NBP1-59922] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: RCE1 Antibody [NBP1-59922] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ZMPSTE24 Antibody
NB100-2388
Western Blot: ZMPSTE24 Antibody [NB100-2388] - Detection of ZMPSTE24 in human testis.
(1 Publication)
Species: Hu
Applications: WB
RhoA Antibody
NB100-91273
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry-Paraffin: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin section) using Rabbit antibody to Transforming protein RhoA (Arha, Arha2): whole serum at 1 : 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
(1 Review)
(4 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HRAS Antibody
NBP2-42864
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HRAS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-RAS antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-Ras antibody diluted at 1:5000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen: Rhodopsin Antibody (4D2) [NBP2-59690] - Zebrafish retina (outer nuclear layer). PFA and methanol fixed 7 um sections. Rhodopsin antibody O/N incubation at 1:500. IHC-Fr image submitted by a verified customer review.
Western Blot: Rhodopsin Antibody (4D2) [NBP2-59690] - Western Blot analysis of Bovine photoreceptor membranes showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 4D2 (NBP2-59690). Lane 1: MW ladder. Lane 2: 10 ug. Lane 3: 5 ug. Lane 4: 2.5 ug.. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody (NBP2-59690) at 1:1000.
Immunohistochemistry: Rhodopsin Antibody (4D2) [NBP2-59690] - Immunohistochemistry analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 4D2 (NBP2-59690). Tissue: retina. Species: Mouse. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody (NBP2-59690) at 1:1000. Secondary Antibody: FITC Goat Anti-Mouse (green). Counterstain: DAPI (blue) nuclear stain. Localization: Staining of photoreceptor outer segment (OS). Other layers of the retina: IS inner segment; ONL outer nuclear layer; OPL outer plexiform layer; INL inner nuclear layer; IPL inner plexiform layer; GCL ganglion cell layer..
(1 Review)
(3 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Ataxin 1 Antibody
(2F5)
NBP1-51689
Western Blot: Ataxin 1 Antibody (2F5) [NBP1-51689] - Analysis using ATXN1 mab against HEK293 (1) and ATXN1 higGFC transfected HEK293 (2) cell lysate.
Flow Cytometry: Ataxin 1 Antibody (2F5) [NBP1-51689] - Flow cytometric analysis of Jurket cells using ATXN1 mouse mAb (green) and negative control (purple).
Immunohistochemistry-Paraffin: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues (left) and lung cancer tissues (right) using ATXN1 mouse mAb with DAB staining.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.
Species: Hu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord (ventral horn) using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(28 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Rheb Antibody
(2C11)
H00006009-M01
Western Blot: Rheb Antibody (2C11) [H00006009-M01] - RHEB monoclonal antibody (M01), clone 2C11. Analysis of RHEB expression in NIH/3T3.
ELISA: Rheb Antibody (2C11) [H00006009-M01] - Detection limit for recombinant GST tagged RHEB is approximately 3ng/ml as a capture antibody.
Western Blot: Rheb Antibody (2C11) [H00006009-M01] - RHEB monoclonal antibody (M01), clone 2C11. Analysis of RHEB expression in PC-12.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
N/A: TOR/mTOR [p Ser2448] Antibody [NB600-607]
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB

Publications for ICMT Recombinant Protein Antigen (NBP2-38198PEP) (0)

There are no publications for ICMT Recombinant Protein Antigen (NBP2-38198PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICMT Recombinant Protein Antigen (NBP2-38198PEP) (0)

There are no reviews for ICMT Recombinant Protein Antigen (NBP2-38198PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ICMT Recombinant Protein Antigen (NBP2-38198PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ICMT Products

Bioinformatics Tool for ICMT Recombinant Protein Antigen (NBP2-38198PEP)

Discover related pathways, diseases and genes to ICMT Recombinant Protein Antigen (NBP2-38198PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICMT Recombinant Protein Antigen (NBP2-38198PEP)

Discover more about diseases related to ICMT Recombinant Protein Antigen (NBP2-38198PEP).
 

Pathways for ICMT Recombinant Protein Antigen (NBP2-38198PEP)

View related products by pathway.

PTMs for ICMT Recombinant Protein Antigen (NBP2-38198PEP)

Learn more about PTMs related to ICMT Recombinant Protein Antigen (NBP2-38198PEP).
 

Research Areas for ICMT Recombinant Protein Antigen (NBP2-38198PEP)

Find related products by research area.

Blogs on ICMT

There are no specific blogs for ICMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ICMT Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ICMT