Recombinant Human ICMT GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ICMT GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 86-154 of Human ICMT

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ICMT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
33.33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ICMT GST (N-Term) Protein

  • EC 2.1.1.100
  • HSTE14
  • ICMT
  • Isoprenylcysteine Carboxyl Methyltransferase
  • Isoprenylcysteine carboxylmethyltransferase
  • MST098
  • MSTP098
  • pcCMT
  • PCMT
  • PPMT
  • Prenylated Protein Carboxyl Methyltransferase
  • Protein-S-Isoprenylcysteine O-Methyltransferase

Background

ICMT - isoprenylcysteine carboxyl methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59922
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2388
Species: Hu
Applications: WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00006009-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB

Publications for ICMT Partial Recombinant Protein (H00023463-Q01) (0)

There are no publications for ICMT Partial Recombinant Protein (H00023463-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICMT Partial Recombinant Protein (H00023463-Q01) (0)

There are no reviews for ICMT Partial Recombinant Protein (H00023463-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICMT Partial Recombinant Protein (H00023463-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ICMT Products

Bioinformatics Tool for ICMT Partial Recombinant Protein (H00023463-Q01)

Discover related pathways, diseases and genes to ICMT Partial Recombinant Protein (H00023463-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICMT Partial Recombinant Protein (H00023463-Q01)

Discover more about diseases related to ICMT Partial Recombinant Protein (H00023463-Q01).
 

Pathways for ICMT Partial Recombinant Protein (H00023463-Q01)

View related products by pathway.

PTMs for ICMT Partial Recombinant Protein (H00023463-Q01)

Learn more about PTMs related to ICMT Partial Recombinant Protein (H00023463-Q01).
 

Research Areas for ICMT Partial Recombinant Protein (H00023463-Q01)

Find related products by research area.

Blogs on ICMT

There are no specific blogs for ICMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ICMT GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ICMT