Hydrogen Potassium ATPase Beta Antibody (1D10)

Images

 
ELISA: Hydrogen Potassium ATPase Beta Antibody (1D10) [H00000496-M10] - Detection limit for recombinant GST tagged ATP4B is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hydrogen Potassium ATPase Beta Antibody (1D10) Summary

Immunogen
ATP4B (NP_000696.1, 67 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGK
Specificity
ATP4B - ATPase, H+/K+ exchanging, beta polypeptide (1D10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP4B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hydrogen Potassium ATPase Beta Antibody (1D10)

  • ATP4B
  • ATP6B
  • ATPase, H+/K+ exchanging, beta polypeptide
  • ATPase, H+/K+ transporting, beta polypeptide
  • Gastric H(+)/K(+) ATPase subunit beta
  • gastric H+/K+ ATPase beta subunit
  • gastric hydrogen-potassium ATPase, beta
  • Hydrogen Potassium ATPase Beta
  • potassium-transporting ATPase beta chain
  • potassium-transporting ATPase subunit beta
  • Proton pump beta chain

Background

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88889
Species: Hu
Applications: IHC, IHC-P
DCX900
Species: Hu
Applications: ELISA
NBP1-92180
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-33284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-27544
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
AF009
Species: Hu
Applications: IHC, WB
NBP1-78249
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-16679
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB600-1182
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
288-TPN/CF
Species: Hu
Applications: BA
NBP2-24951
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91816
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10) (0)

There are no publications for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10) (0)

There are no reviews for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10). (Showing 1 - 1 of 1 FAQ).

  1. H00000496-Q01 is this the antigen for producing this antibody?
    • Yes H00000496-Q01 is the antigen for H00000496-M10.

Secondary Antibodies

 

Isotype Controls

Additional Hydrogen Potassium ATPase Beta Products

Bioinformatics Tool for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10)

Discover related pathways, diseases and genes to Hydrogen Potassium ATPase Beta Antibody (H00000496-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10)

Discover more about diseases related to Hydrogen Potassium ATPase Beta Antibody (H00000496-M10).
 

Pathways for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10)

View related products by pathway.

Research Areas for Hydrogen Potassium ATPase Beta Antibody (H00000496-M10)

Find related products by research area.

Blogs on Hydrogen Potassium ATPase Beta

There are no specific blogs for Hydrogen Potassium ATPase Beta, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hydrogen Potassium ATPase Beta Antibody (1D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP4B
Entrez
Uniprot