HVEM/TNFRSF14 Antibody (2G6-2C7)

Images

 
Western Blot: HVEM/TNFRSF14 Antibody (2G6-2C7) [H00008764-M01] - Analysis of TNFRSF14 expression in transfected 293T cell line by TNFRSF14 monoclonal antibody (M01), clone 2G6-2C7.Lane 1: TNFRSF14 transfected ...read more
Immunohistochemistry-Paraffin: HVEM/TNFRSF14 Antibody (2G6-2C7) [H00008764-M01] - Analysis of monoclonal antibody to TNFRSF14 on formalin-fixed paraffin-embedded human pancreatic cancer. Antibody concentration 1 ug/ml.
ELISA: HVEM/TNFRSF14 Antibody (2G6-2C7) [H00008764-M01] - Detection limit for recombinant GST tagged TNFRSF14 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2G6-2C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HVEM/TNFRSF14 Antibody (2G6-2C7) Summary

Immunogen
TNFRSF14 (AAH02794, 38 a.a. - 283 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
Specificity
TNFRSF14 - tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNFRSF14
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HVEM/TNFRSF14 Antibody (2G6-2C7)

  • ATAR
  • CD270 antigen
  • CD270
  • CD40-like protein
  • Herpes virus entry mediator A
  • Herpesvirus entry mediator A
  • HveA
  • HVEM
  • HVEMTR2HVEAATAR
  • LIGHTR
  • TNFRSF14
  • tumor necrosis factor receptor superfamily member 14
  • tumor necrosis factor receptor superfamily, member 14 (herpesvirus entrymediator)
  • Tumor necrosis factor receptor-like 2
  • tumor necrosis factor receptor-like gene2

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45549
Species: Hu
Applications: WB, Flow, IHC
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-20571
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-46228
Species: Hu
Applications: WB, IHC
AF2229
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
H00008764-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for HVEM/TNFRSF14 Antibody (H00008764-M01) (0)

There are no publications for HVEM/TNFRSF14 Antibody (H00008764-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HVEM/TNFRSF14 Antibody (H00008764-M01) (0)

There are no reviews for HVEM/TNFRSF14 Antibody (H00008764-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HVEM/TNFRSF14 Antibody (H00008764-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HVEM/TNFRSF14 Products

Bioinformatics Tool for HVEM/TNFRSF14 Antibody (H00008764-M01)

Discover related pathways, diseases and genes to HVEM/TNFRSF14 Antibody (H00008764-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HVEM/TNFRSF14 Antibody (H00008764-M01)

Discover more about diseases related to HVEM/TNFRSF14 Antibody (H00008764-M01).
 

Pathways for HVEM/TNFRSF14 Antibody (H00008764-M01)

View related products by pathway.

PTMs for HVEM/TNFRSF14 Antibody (H00008764-M01)

Learn more about PTMs related to HVEM/TNFRSF14 Antibody (H00008764-M01).
 

Research Areas for HVEM/TNFRSF14 Antibody (H00008764-M01)

Find related products by research area.

Blogs on HVEM/TNFRSF14

There are no specific blogs for HVEM/TNFRSF14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HVEM/TNFRSF14 Antibody (2G6-2C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF14
Entrez
OMIM
Uniprot