Recombinant Human HSPC014 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HSPC014 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-141 of Human C13orf12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL

Protein/Peptide Type
Recombinant Protein
Gene
POMP

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HSPC014 Protein

  • C13orf12
  • chromosome 13 open reading frame 12
  • HSPC014
  • hUMP1
  • PNAS-110
  • proteasome maturation protein
  • proteassemblin
  • Protein UMP1 homolog
  • UMP12510048O06Rik
  • Voltage-gated K channel beta subunit 4.1
  • voltage-gated potassium channel beta subunit 4.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP2-12553
Species: Hu
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00051371-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for HSPC014 Recombinant Protein (H00051371-P01) (0)

There are no publications for HSPC014 Recombinant Protein (H00051371-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPC014 Recombinant Protein (H00051371-P01) (0)

There are no reviews for HSPC014 Recombinant Protein (H00051371-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSPC014 Recombinant Protein (H00051371-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSPC014 Products

Bioinformatics Tool for HSPC014 Recombinant Protein (H00051371-P01)

Discover related pathways, diseases and genes to HSPC014 Recombinant Protein (H00051371-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPC014 Recombinant Protein (H00051371-P01)

Discover more about diseases related to HSPC014 Recombinant Protein (H00051371-P01).
 

Pathways for HSPC014 Recombinant Protein (H00051371-P01)

View related products by pathway.

PTMs for HSPC014 Recombinant Protein (H00051371-P01)

Learn more about PTMs related to HSPC014 Recombinant Protein (H00051371-P01).

Blogs on HSPC014

There are no specific blogs for HSPC014, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HSPC014 Antibody
NBP1-90734

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HSPC014 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POMP