HspBP1 Recombinant Protein Antigen

Images

 
There are currently no images for HspBP1 Recombinant Protein Antigen (NBP3-17868PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HspBP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HspBP1

Source: E. coli

Amino Acid Sequence: LELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17868.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HspBP1 Recombinant Protein Antigen

  • FES1
  • Heat shock protein-binding protein 1
  • Hsp70 binding protein 1
  • hsp70 interacting protein
  • hsp70-binding protein 1
  • Hsp70-binding protein 2
  • Hsp70-interacting protein 1
  • Hsp70-interacting protein 2
  • HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
  • HSPBP
  • HspBP1
  • hspBP2

Background

Heat shock protein binding protein is an Hsp70-interacting protein that was first isolated from a human heart cDNA library using the yeast two-hybrid system. HspBP1 binds the ATPase domain of Hsp70, and inhibits Hsp70 chaperone activity. More recently HspBP1 was found to promote nucleotide dissociation from Hsc70 and is capable of altering the confirmation of the Hsp70 ATPase domain. HspBP1 is capable of regulating any Hsp70 activity that requires ATPase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-75440
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-47427
Species: Ca, Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-56719
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP1-87122
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56082
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
AF4029
Species: Hu, Mu, Rt
Applications: IHC, WB
AF2314
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-56087
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-97503
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC,  IHC-P, IP, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for HspBP1 Recombinant Protein Antigen (NBP3-17868PEP) (0)

There are no publications for HspBP1 Recombinant Protein Antigen (NBP3-17868PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HspBP1 Recombinant Protein Antigen (NBP3-17868PEP) (0)

There are no reviews for HspBP1 Recombinant Protein Antigen (NBP3-17868PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HspBP1 Recombinant Protein Antigen (NBP3-17868PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HspBP1 Products

Research Areas for HspBP1 Recombinant Protein Antigen (NBP3-17868PEP)

Find related products by research area.

Blogs on HspBP1

There are no specific blogs for HspBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HspBP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPBP1