HSPB8/HSP22 Antibody

Images

 
Western Blot: HSPB8/HSP22 Antibody [NBP1-84945] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HSPB8 antibody. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: HSPB8/HSP22 Antibody [NBP1-84945] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: HSPB8/HSP22 Antibody [NBP1-84945] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: HSPB8/HSP22 Antibody [NBP1-84945] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: HSPB8/HSP22 Antibody [NBP1-84945] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: HSPB8/HSP22 Antibody [NBP1-84945] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSPB8/HSP22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLP
Specificity
Specificity of human HSPB8/HSP22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPB8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSPB8/HSP22 Protein (NBP1-84945PEP)
Publications
Read Publication using NBP1-84945.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSPB8/HSP22 Antibody

  • Alpha-crystallin C chain
  • CMT2L
  • CRYAC
  • DHMN2
  • E2IG1
  • E2IG1E2-induced gene 1 protein
  • H11
  • H11DHMN2
  • heat shock 22kDa protein 8
  • heat shock 27kDa protein 8
  • heat shock protein beta-8
  • HMN2
  • HMN2A
  • HSP22
  • HSP22CMT2L
  • HSPB8
  • Protein kinase H11
  • Small stress protein-like protein HSP22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67815
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-2519
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38713
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-99273
Species: Mu
Applications: WB, IHC, IHC-P, IP
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16772
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003166-B01P-50ug
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: WB, IHC
AF2584
Species: Mu
Applications: WB, Simple Western
NBP1-84945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for HSPB8/HSP22 Antibody (NBP1-84945)(1)

Reviews for HSPB8/HSP22 Antibody (NBP1-84945) (0)

There are no reviews for HSPB8/HSP22 Antibody (NBP1-84945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSPB8/HSP22 Antibody (NBP1-84945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSPB8/HSP22 Products

Bioinformatics Tool for HSPB8/HSP22 Antibody (NBP1-84945)

Discover related pathways, diseases and genes to HSPB8/HSP22 Antibody (NBP1-84945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPB8/HSP22 Antibody (NBP1-84945)

Discover more about diseases related to HSPB8/HSP22 Antibody (NBP1-84945).
 

Pathways for HSPB8/HSP22 Antibody (NBP1-84945)

View related products by pathway.

PTMs for HSPB8/HSP22 Antibody (NBP1-84945)

Learn more about PTMs related to HSPB8/HSP22 Antibody (NBP1-84945).
 

Research Areas for HSPB8/HSP22 Antibody (NBP1-84945)

Find related products by research area.

Blogs on HSPB8/HSP22

There are no specific blogs for HSPB8/HSP22, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSPB8/HSP22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPB8