HspB7 Antibody

Images

 
Western Blot: HspB7 Antibody [NBP1-69071] - Mouse Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HspB7 Antibody Summary

Immunogen
Synthetic peptides corresponding to Hspb7 (heat shock protein family, member 7 (cardiovascular)) The peptide sequence was selected from the C terminal of Hspb7. Peptide sequence TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRNPHTEHVQQTFRTEIKI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPB7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Hspb7 and was validated on Western blot.
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HspB7 Antibody

  • Cardiovascular heat shock protein
  • cvHSP
  • DKFZp779D0968
  • FLJ32733
  • heat shock 27kDa protein family, member 7 (cardiovascular)
  • heat shock protein beta-7
  • HspB7
  • member 7 (cardiovascular)

Background

The function of Hspb7 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
MAB4200
Species: Hu, Mu, Rt
Applications: WB
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
AF2584
Species: Mu
Applications: WB, Simple Western
NBP2-57219
Species: Hu
Applications: ICC/IF
NBL1-11762
Species: Hu
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
NBP2-38050
Species: Hu
Applications: IHC, IHC-P
NBP2-46842
Species: Hu
Applications: IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-13469
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC

Publications for HspB7 Antibody (NBP1-69071) (0)

There are no publications for HspB7 Antibody (NBP1-69071).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HspB7 Antibody (NBP1-69071) (0)

There are no reviews for HspB7 Antibody (NBP1-69071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HspB7 Antibody (NBP1-69071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HspB7 Products

Bioinformatics Tool for HspB7 Antibody (NBP1-69071)

Discover related pathways, diseases and genes to HspB7 Antibody (NBP1-69071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HspB7 Antibody (NBP1-69071)

Discover more about diseases related to HspB7 Antibody (NBP1-69071).
 

Pathways for HspB7 Antibody (NBP1-69071)

View related products by pathway.

Blogs on HspB7

There are no specific blogs for HspB7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HspB7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPB7
Uniprot