HspB2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HspB2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HspB2
  
  

  Source: E.coli

  Amino Acid Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HSPB2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17723It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HspB2 Recombinant Protein Antigen

• DMPK-binding protein
• HspB2
• MKBP

Background

In muscle cells, HspB2 interacts with HspB3 to form a large independent polydisperse assembly. Unfortuantely, little is known about the function of this complex. However, co-immunoprecipitation has shown that despite a high level of sequence homology within the sHSP family, the HSPB2/B3 complex is distinctly different from the biochemical properties of other sHSPs. Therefore, the HSPB2/B3 assembly is believed to perform cellular functions that are distinctly different than those of its family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSPB2