HspA12B Antibody

Images

 
Immunohistochemistry-Paraffin: HspA12B Antibody [NBP1-88294] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HspA12B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTTSSGYAFSFASDPEAIHMMRKWEGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA12B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
HspA12B Protein (NBP1-88294PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HspA12B Antibody

  • C20orf60
  • chromosome 20 open reading frame 60
  • dJ1009E24.2
  • FLJ32150
  • heat shock 70 kDa protein 12B
  • heat shock 70kD protein 12B
  • MGC131912

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4029
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-94014
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-88294
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for HspA12B Antibody (NBP1-88294) (0)

There are no publications for HspA12B Antibody (NBP1-88294).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HspA12B Antibody (NBP1-88294) (0)

There are no reviews for HspA12B Antibody (NBP1-88294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HspA12B Antibody (NBP1-88294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HspA12B Products

Bioinformatics Tool for HspA12B Antibody (NBP1-88294)

Discover related pathways, diseases and genes to HspA12B Antibody (NBP1-88294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HspA12B Antibody (NBP1-88294)

Discover more about diseases related to HspA12B Antibody (NBP1-88294).
 

Pathways for HspA12B Antibody (NBP1-88294)

View related products by pathway.

PTMs for HspA12B Antibody (NBP1-88294)

Learn more about PTMs related to HspA12B Antibody (NBP1-88294).

Blogs on HspA12B

There are no specific blogs for HspA12B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HspA12B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA12B