HSFY2 Antibody

Images

 
Western Blot: HSFY2 Antibody [NBP1-80247] - NIH-3T3 cells lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSFY2 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human HSFY2. Peptide sequence EMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSFY2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against HSFY2 and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSFY2 Antibody

  • FLJ25453
  • Heat shock transcription factor 2-like protein
  • heat shock transcription factor, Y linked 2
  • heat shock transcription factor, Y-linked
  • HSF2L
  • HSF2-like
  • HSFY
  • HSFY1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-85808
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41198
Species: Hu, Mu
Applications: WB, ELISA
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
H00009426-R01
Species: Hu
22240002
Species: Hu
Applications: WB, ELISA
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00008653-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-79749
Species: Hu
Applications: WB
AF5227
Species: Hu, Mu
Applications: WB
NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00003281-R01
Species: Hu
NBP2-30949
Species: Hu
Applications: IHC, IHC-P

Publications for HSFY2 Antibody (NBP1-80247) (0)

There are no publications for HSFY2 Antibody (NBP1-80247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSFY2 Antibody (NBP1-80247) (0)

There are no reviews for HSFY2 Antibody (NBP1-80247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSFY2 Antibody (NBP1-80247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSFY2 Products

Bioinformatics Tool for HSFY2 Antibody (NBP1-80247)

Discover related pathways, diseases and genes to HSFY2 Antibody (NBP1-80247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSFY2 Antibody (NBP1-80247)

Discover more about diseases related to HSFY2 Antibody (NBP1-80247).
 

Pathways for HSFY2 Antibody (NBP1-80247)

View related products by pathway.

Blogs on HSFY2

There are no specific blogs for HSFY2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSFY2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSFY2
Uniprot