RPS4Y2 Antibody

Images

 
Western Blot: RPS4Y2 Antibody [NBP3-09558] - Western blot analysis of RPS4Y2 in 721_B Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS4Y2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPS4Y2 (NP_001034656). Peptide sequence NGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS4Y2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for RPS4Y2 Antibody

  • RPS4Y2P

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB
H00159119-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-16888
Species: Mu, Rt
Applications: WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-46488
Species: Hu, Mu, Rt
Applications: WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00006187-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-32887
Species: Hu
Applications: IHC, IHC-P, WB
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00009426-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for RPS4Y2 Antibody (NBP3-09558) (0)

There are no publications for RPS4Y2 Antibody (NBP3-09558).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS4Y2 Antibody (NBP3-09558) (0)

There are no reviews for RPS4Y2 Antibody (NBP3-09558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS4Y2 Antibody (NBP3-09558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS4Y2 Products

Array NBP3-09558

Bioinformatics Tool for RPS4Y2 Antibody (NBP3-09558)

Discover related pathways, diseases and genes to RPS4Y2 Antibody (NBP3-09558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS4Y2 Antibody (NBP3-09558)

Discover more about diseases related to RPS4Y2 Antibody (NBP3-09558).
 

Pathways for RPS4Y2 Antibody (NBP3-09558)

View related products by pathway.

Blogs on RPS4Y2

There are no specific blogs for RPS4Y2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS4Y2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS4Y2