Home » HSFY1 » HSFY1 Antibodies » HSFY1 Antibody

HSFY1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: HSFY1 Antibody [NBP1-80129] - Human Liver cell lysate, concentration 5.0ug/ml.
Western Blot: HSFY1 Antibody [NBP1-80129] - Human Liver cell lysate, concentration 5.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HSFY1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human HSFY1 (NP_149099). Peptide sequence SWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNLYGFSKI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSFY1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HSFY1 and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-80129.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSFY1 Antibody

  • FLJ25453
  • Heat shock transcription factor 2-like protein
  • heat shock transcription factor, Y linked 2
  • heat shock transcription factor, Y-linked
  • HSF2L
  • HSF2-like
  • HSFY
  • HSFY1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RBMY1A1 Antibody
NBP1-32887
Immunohistochemistry-Paraffin: RBMY1A1 Antibody [NBP1-32887] - Paraffin-embedded SAS Xenograft, using antibody at 1:100 dilution.
Western Blot: RBMY1A1 Antibody [NBP1-32887] - A. 30 ug NT2D1 whole cell lysate/extract, B. 30 ug PC-3 whole cell lysate/extract 7. 5 % SDS-PAGE gel, antibody dilution 1:1000.
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
TSPY1 GST (N-Term) Pr ...
H00007258-Q01
SDS-Page: Recombinant Human TSPY1 Protein [H00007258-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
EIF1AY
Overexpression Lysate
NBL1-10172
Western Blot: EIF1AY Overexpression Lysate (Adult Normal) [NBL1-10172] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for EIF1AY.
Species: Hu
Applications: WB
Recombinant Human
SLC10A4 GST (N-Term) ...
H00201780-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
RPS4Y2 Antibody
NBP3-09558
Western Blot: RPS4Y2 Antibody [NBP3-09558] - Western blot analysis of RPS4Y2 in 721_B Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml
Species: Hu
Applications: WB
Recombinant Human
CDY2A GST (N-Term) Pr ...
H00009426-Q01
SDS-Page: Recombinant Human CDY2A Protein [H00009426-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
IL-6 [HRP]
D6050
(32 Reviews)
(605 Publications)
Species: Hu
Applications: ELISA
DAZ1 Antibody
(3G10)
H00001617-M01
Western Blot: DAZ1 Antibody (3G10) [H00001617-M01] - DAZ1 monoclonal antibody (M01), clone 3G10. Analysis of DAZ1 expression in human pancreas.
Immunocytochemistry/Immunofluorescence: DAZ1 Antibody (3G10) [H00001617-M01] - Analysis of monoclonal antibody to DAZ1 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: DAZ1 Antibody (3G10) [H00001617-M01] - Analysis of monoclonal antibody to DAZ1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
DDX3Y Antibody
NBP3-16963
Immunocytochemistry/Immunofluorescence: DDX3Y Antibody [NBP3-16963] - Analysis in human testis and endometrium tissues using Anti-DDX3Y antibody. Corresponding DDX3Y RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DDX3Y Antibody [NBP3-16963] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: DDX3Y Antibody [NBP3-16963] - Staining of human endometrium shows low expression as expected.
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
USP9Y Antibody
NBP3-16073
Immunohistochemistry-Paraffin: USP9Y Antibody [NBP3-16073] - Immunohistochemistry of paraffin-embedded mouse kidney using USP9Y Rabbit pAb (NBP3-16073) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: USP9Y Antibody [NBP3-16073] - Immunohistochemistry of paraffin-embedded mouse testis using USP9Y Rabbit pAb (NBP3-16073) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: USP9Y Antibody [NBP3-16073] - Western blot analysis of extracts of various cell lines, using USP9Y antibody (NBP3-16073) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HSFY2 Antibody
(4B7)
H00159119-M02
Immunocytochemistry/Immunofluorescence: HSFY2 Antibody (4B7) [H00159119-M02] - Analysis of monoclonal antibody to HSFY2 on HeLa cell . Antibody concentration 10 ug/ml.
Western Blot: HSFY2 Antibody (4B7) [H00159119-M02] - Analysis of HSFY2 expression in transfected 293T cell line by HSFY2 monoclonal antibody (M02), clone 4B7.Lane 1: HSFY2 transfected lysate (Predicted MW: 23.4 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: HSFY2 Antibody (4B7) [H00159119-M02] - Detection limit for recombinant GST tagged HSFY2 is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
HSF2 Antibody
(JE48-40)
NBP2-80457
Flow Cytometry: HSF2 Antibody (JE48-40) [NBP2-80457] - Analysis of HSF2 was done on 293 cells. The cells were fixed, permeabilized and stained with Carcino Embryonic Antigen CEA antibody at 1/100 dilution (red) compared with an unlabeled control (cells without incubation with primary antibody; black). After incubation of the primary antibody on room temperature for an hour, the cells was stained with a Alexa Fluor (TM) 488-conjugated goat anti-rabbit IgG Secondary antibody at 1/500 dilution for 30 minutes.
Immunocytochemistry/Immunofluorescence: HSF2 Antibody (JE48-40) [NBP2-80457] - Staining of HSF2 in HepG2 cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the primary antibody (, 1/50) for 1 hour at room temperature, washed with PBS. Alexa Fluor488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Immunohistochemistry-Paraffin: HSF2 Antibody (JE48-40) [NBP2-80457] - Analysis in human breast cancer tissue using CRIPTO antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, wash
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HSF1 [p Ser326]
Antibody (SU31-03)
NBP2-67455
Flow Cytometry: HSF1 [p Ser326] Antibody (SU31-03) [NBP2-67455] - Analysis of Hela cells with p-HSF1(S326) antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary
Immunocytochemistry/Immunofluorescence: HSF1 [p Ser326] Antibody (SU31-03) [NBP2-67455] - Staining p-HSF1(S326) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: HSF1 [p Ser326] Antibody (SU31-03) [NBP2-67455] - Staining p-HSF1(S326) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SRY Antibody (1G4)
- BSA Free
NBP2-37463
ELISA: SRY Antibody (1G4) [NBP2-37463] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: SRY Antibody (1G4) [NBP2-37463] - Analysis using SRY mAb against human SRY recombinant protein. (Expected MW is 49.4 kDa)
Western Blot: SRY Antibody (1G4) [NBP2-37463] - Analysis using SRY mouse mAb against NTERA-2 (1) cell lysate.
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
UCH-L1/PGP9.5
Antibody (31A3)
NB600-1160
Flow Cytometry: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Flow Cytometric Analysis of T98G cells using UCH-L1/PGP9.5 Antibody (31A3)followed by Goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
Immunocytochemistry/Immunofluorescence: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Immunofluorescence Analysis of T98G cells labeling Pgp9.5 with UCH-L1/PGP9.5 Antibody (31A3) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Nucspot (Red)
Western Blot: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Western Blot Analysis of human brain tissue lysate using UCH-L1/PGP9.5 Antibody (31A3)
(1 Review)
(14 Publications)
Species: Bv, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
HSBP1 Antibody
NBP2-84079
Western Blot: HSBP1 Antibody [NBP2-84079] - Host: Rabbit. Target: HSBP1. Positive control (+): Human Brain (BR). Negative control (-): Human Fetal Heart (HE). Antibody concentration: 1ug/ml
Western Blot: HSBP1 Antibody [NBP2-84079] - WB Suggested Anti-HSBP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain
Species: Hu
Applications: WB
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining in human testis and endometrium tissues.. Corresponding PRM1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P

Publications for HSFY1 Antibody (NBP1-80129)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-80129 Applications Species
Shinka,T et al. Biol. Reprod. 71 (1), 297-306. 2004 [PMID: 15044259]

Reviews for HSFY1 Antibody (NBP1-80129) (0)

There are no reviews for HSFY1 Antibody (NBP1-80129). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSFY1 Antibody (NBP1-80129) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSFY1 Products

Bioinformatics Tool for HSFY1 Antibody (NBP1-80129)

Discover related pathways, diseases and genes to HSFY1 Antibody (NBP1-80129). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSFY1 Antibody (NBP1-80129)

Discover more about diseases related to HSFY1 Antibody (NBP1-80129).
 

Pathways for HSFY1 Antibody (NBP1-80129)

View related products by pathway.

Blogs on HSFY1

There are no specific blogs for HSFY1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSFY1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HSFY1
Entrez
Uniprot