HSF2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSF2. Source: E. coli
Amino Acid Sequence: LGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HSF2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86330. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for HSF2 Recombinant Protein Antigen
Background
Heat shock factor 1 (HSF1) is a heat shock transcription factor that activates the transcription of genes encoding products required for protein folding, processing, targeting, degradation, and function. Up-regulation of expression of heat shock proteins in response to stress occurs at the level of transcription through a heat shock element and a HSF transcription factor. Amino acid sequences for most HSFs are highly conserved. A DNA binding domain is at the N-terminus, hydrophobic repeats (essential to the formation of active trimers) are adjacent to this binding domain, and another short hydrophobic repeat (necessary for suppression of trimerization) occurs toward the C-terminus. HSF2 exists as two isoforms, the alpha form being more transcriptionally active than the smaller beta form. Various experiments have suggested that HSF2 may play roles in differentiation and development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ma, Hu, Mu, Pm, Rb, Rt
Applications: ELISA, GS, IP, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Publications for HSF2 Protein (NBP1-86330PEP) (0)
There are no publications for HSF2 Protein (NBP1-86330PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HSF2 Protein (NBP1-86330PEP) (0)
There are no reviews for HSF2 Protein (NBP1-86330PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HSF2 Protein (NBP1-86330PEP) (0)
Additional HSF2 Products
Research Areas for HSF2 Protein (NBP1-86330PEP)
Find related products by research area.
|
Blogs on HSF2