HOXC9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HOXC9 Antibody [NBP2-58032] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXC9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAY
Specificity
Specificity of human HOXC9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXC9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXC9 Recombinant Protein Antigen (NBP2-58032PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HOXC9 Antibody

  • homeobox C9
  • Homeobox protein Hox-3B
  • homeobox protein Hox-C9
  • HOX3
  • HOX3Bhomeo box C9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55738
Species: Hu
Applications: ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003219-D03P
Species: Hu, Mu
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
H00003213-Q01
Species: Hu
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-54948
Species: Hu
Applications: ICC/IF
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
H00003237-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003209-Q01
Species: Hu
NBP2-56537
Species: Hu
Applications: ICC/IF

Publications for HOXC9 Antibody (NBP2-58032) (0)

There are no publications for HOXC9 Antibody (NBP2-58032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC9 Antibody (NBP2-58032) (0)

There are no reviews for HOXC9 Antibody (NBP2-58032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXC9 Antibody (NBP2-58032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HOXC9 Antibody (NBP2-58032)

Discover related pathways, diseases and genes to HOXC9 Antibody (NBP2-58032). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC9 Antibody (NBP2-58032)

Discover more about diseases related to HOXC9 Antibody (NBP2-58032).
 

Pathways for HOXC9 Antibody (NBP2-58032)

View related products by pathway.

PTMs for HOXC9 Antibody (NBP2-58032)

Learn more about PTMs related to HOXC9 Antibody (NBP2-58032).

Blogs on HOXC9

There are no specific blogs for HOXC9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC9