HOXC8 Antibody

Images

 
Western Blot: HOXC8 Antibody [H00003224-D01P] - Analysis of HOXC8 expression in transfected 293T cell line by HOXC8 polyclonal antibody.Lane 1: HOXC8 transfected lysate(27.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXC8 Antibody Summary

Immunogen
HOXC8 (NP_073149.1, 1 a.a. - 242 a.a.) full-length human protein. MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD
Specificity
HOXC8 - homeobox C8,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXC8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC8 Antibody

  • homeo box C8
  • homeobox C8
  • Homeobox protein Hox-3A
  • homeobox protein Hox-C8
  • HOX3
  • Hox-3.1, mouse, homolog of
  • HOX3Ahomeo box 3A

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003223-M04
Species: Hu
Applications: WB, ELISA
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91973
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-56537
Species: Hu
Applications: ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55738
Species: Hu
Applications: ICC/IF
NB600-248
Species: Hu
Applications: WB, IP
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-56557
Species: Hu
Applications: ICC/IF
NBL1-11664
Species: Hu
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
H00003224-D01P
Species: Hu
Applications: WB

Publications for HOXC8 Antibody (H00003224-D01P) (0)

There are no publications for HOXC8 Antibody (H00003224-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC8 Antibody (H00003224-D01P) (0)

There are no reviews for HOXC8 Antibody (H00003224-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC8 Antibody (H00003224-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC8 Products

Bioinformatics Tool for HOXC8 Antibody (H00003224-D01P)

Discover related pathways, diseases and genes to HOXC8 Antibody (H00003224-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC8 Antibody (H00003224-D01P)

Discover more about diseases related to HOXC8 Antibody (H00003224-D01P).
 

Pathways for HOXC8 Antibody (H00003224-D01P)

View related products by pathway.

PTMs for HOXC8 Antibody (H00003224-D01P)

Learn more about PTMs related to HOXC8 Antibody (H00003224-D01P).

Blogs on HOXC8

There are no specific blogs for HOXC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC8
Entrez
Uniprot