HOXC5 Antibody

Images

 
Western Blot: HOXC5 Antibody [NBP2-85066] - WB Suggested Anti-HOXC5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: ACHN cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXC5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HOXC5. Peptide sequence: KEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HOXC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXC5 Antibody

  • homeo box C5
  • homeobox C5
  • Homeobox protein CP11
  • Homeobox protein Hox-3D
  • homeobox protein Hox-C5
  • HOX3
  • HOX3DCP11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56195
Species: Hu
Applications: ICC/IF, WB
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP2-85076
Species: Hu
Applications: WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
H00003237-M10
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
H00003231-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP3-16827
Species: Hu, Mu, Rt
Applications: WB
H00003213-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB

Publications for HOXC5 Antibody (NBP2-85066) (0)

There are no publications for HOXC5 Antibody (NBP2-85066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC5 Antibody (NBP2-85066) (0)

There are no reviews for HOXC5 Antibody (NBP2-85066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC5 Antibody (NBP2-85066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC5