HOXC12 Antibody

Images

 
Immunohistochemistry: HOXC12 Antibody [NBP2-31608] - Staining of human colon shows positivity in plasma.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXC12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXC12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HOXC12 Protein (NBP2-31608PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXC12 Antibody

  • HOC3F
  • homeo box 3F
  • homeo box C12
  • homeobox C12
  • Homeobox protein Hox-3F
  • homeobox protein Hox-C12
  • HOX3FHOX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57662
Species: Hu
Applications: ICC/IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP1-80228
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
AF6318
Species: Hu
Applications: ICC
NBP2-31608
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for HOXC12 Antibody (NBP2-31608) (0)

There are no publications for HOXC12 Antibody (NBP2-31608).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC12 Antibody (NBP2-31608) (0)

There are no reviews for HOXC12 Antibody (NBP2-31608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HOXC12 Antibody (NBP2-31608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC12 Products

Bioinformatics Tool for HOXC12 Antibody (NBP2-31608)

Discover related pathways, diseases and genes to HOXC12 Antibody (NBP2-31608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC12 Antibody (NBP2-31608)

Discover more about diseases related to HOXC12 Antibody (NBP2-31608).
 

Pathways for HOXC12 Antibody (NBP2-31608)

View related products by pathway.

PTMs for HOXC12 Antibody (NBP2-31608)

Learn more about PTMs related to HOXC12 Antibody (NBP2-31608).

Blogs on HOXC12

There are no specific blogs for HOXC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC12
Uniprot