HOXC12 Antibody


Western Blot: HOXC12 Antibody [NBP1-69214] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

HOXC12 Antibody Summary

Synthetic peptides corresponding to HOXC12 (homeobox C12) The peptide sequence was selected from the C terminal of HOXC12. Peptide sequence NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HOXC12 and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HOXC12 Antibody

  • HOC3F
  • homeo box 3F
  • homeo box C12
  • homeobox C12
  • Homeobox protein Hox-3F
  • homeobox protein Hox-C12


This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC
Species: Hu
Applications: WB

Publications for HOXC12 Antibody (NBP1-69214) (0)

There are no publications for HOXC12 Antibody (NBP1-69214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC12 Antibody (NBP1-69214) (0)

There are no reviews for HOXC12 Antibody (NBP1-69214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC12 Antibody (NBP1-69214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HOXC12 Products

Bioinformatics Tool for HOXC12 Antibody (NBP1-69214)

Discover related pathways, diseases and genes to HOXC12 Antibody (NBP1-69214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC12 Antibody (NBP1-69214)

Discover more about diseases related to HOXC12 Antibody (NBP1-69214).

Pathways for HOXC12 Antibody (NBP1-69214)

View related products by pathway.

PTMs for HOXC12 Antibody (NBP1-69214)

Learn more about PTMs related to HOXC12 Antibody (NBP1-69214).

Blogs on HOXC12

There are no specific blogs for HOXC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXC12 Antibody and receive a gift card or discount.


Gene Symbol HOXC12